Lus10038301 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G18760 153 / 2e-48 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006729 271 / 6e-95 AT3G18760 155 / 2e-49 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G113200 163 / 3e-52 AT3G18760 186 / 1e-61 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01250 Ribosomal_S6 Ribosomal protein S6
Representative CDS sequence
>Lus10038301 pacid=23158346 polypeptide=Lus10038301 locus=Lus10038301.g ID=Lus10038301.BGIv1.0 annot-version=v1.0
ATGCCTCTTTACGACTGCGTGCTTCTATTGAAGCCTCAAGTGGACAGAACATCAATTATGAGTTTGATGACTCGAATAGGAAACCACGTTGCTACCAGAA
ATGGCGTTGTCACTGAAGTGAAATCATTTGGAACTATTCAACTTGGTTATGGCATCAAGAAGCTCGATGGACGATTTTTCAAGGGCCAACTGGTGCAAAT
GACGATGATGGCGACACCCAACATGAACAAGGAGCTTCATTACCTGAACAAGGAGGATCGGTTGCTGAGGTGGCTTCTGACGAAACACCGAAACACTGTC
TACTCTCGTGACGATTACGATGAAGACACTGGAAAGAACGGACTGAAGAAATACTCGTACGGTGGGGGCATCTTAAACTTCCTCGAAAACGACGATGATG
ACGTGGACGAGGACAGCGAGGATGAAGATGATGCTGGTGGCCGTAATGATGATAGACCTCGACTATGA
AA sequence
>Lus10038301 pacid=23158346 polypeptide=Lus10038301 locus=Lus10038301.g ID=Lus10038301.BGIv1.0 annot-version=v1.0
MPLYDCVLLLKPQVDRTSIMSLMTRIGNHVATRNGVVTEVKSFGTIQLGYGIKKLDGRFFKGQLVQMTMMATPNMNKELHYLNKEDRLLRWLLTKHRNTV
YSRDDYDEDTGKNGLKKYSYGGGILNFLENDDDDVDEDSEDEDDAGGRNDDRPRL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G18760 Translation elongation factor... Lus10038301 0 1
AT4G22380 Ribosomal protein L7Ae/L30e/S1... Lus10025435 1.4 0.9150
AT2G02570 nucleic acid binding;RNA bindi... Lus10024458 2.0 0.9036
AT5G58005 Cytochrome c oxidase, subunit ... Lus10021847 3.7 0.8702
AT1G29990 PFD6, PDF6 prefoldin 6 (.1) Lus10023313 3.9 0.8673
AT2G27790 RNA-binding (RRM/RBD/RNP motif... Lus10030600 4.9 0.8952
AT5G59460 scarecrow-like transcription f... Lus10004969 5.5 0.8921
AT2G34520 RPS14 mitochondrial ribosomal protei... Lus10017877 6.8 0.8603
AT3G60360 EDA14, UTP11 U3 SMALL NUCLEOLAR RNA-ASSOCIA... Lus10029059 7.1 0.8401
AT2G37120 S1FA-like DNA-binding protein ... Lus10023177 8.1 0.8618
AT1G26880 Ribosomal protein L34e superfa... Lus10042199 8.9 0.8662

Lus10038301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.