Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14040 91 / 9e-23 Pectin lyase-like superfamily protein (.1) AT3G07850 87 / 1e-21 Pectin lyase-like superfamily protein (.1) AT4G18180 86 / 5e-21 Pectin lyase-like superfamily protein (.1) AT3G59850 86 / 6e-21 Pectin lyase-like superfamily protein (.1) AT2G43870 84 / 2e-20 Pectin lyase-like superfamily protein (.1) AT3G07830 82 / 1e-19 Pectin lyase-like superfamily protein (.1) AT2G43890 81 / 2e-19 Pectin lyase-like superfamily protein (.1) AT3G07820 81 / 3e-19 Pectin lyase-like superfamily protein (.1) AT1G05660 79 / 1e-18 Pectin lyase-like superfamily protein (.1) AT2G43880 78 / 4e-18 Pectin lyase-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023364 [exp] 106 / 7e-31 AT3G14040 110 / 1e-29 Pectin lyase-like superfamily protein (.1) Lus10013784 [exp] 98 / 2e-25 AT5G48140 337 / 2e-113 Pectin lyase-like superfamily protein (.1) Lus10013780 [exp] 98 / 2e-25 AT5G48140 337 / 2e-113 Pectin lyase-like superfamily protein (.1) Lus10039154 [exp] 98 / 2e-25 AT5G48140 335 / 8e-113 Pectin lyase-like superfamily protein (.1) Lus10009606 [exp] 98 / 2e-25 AT3G07840 323 / 4e-108 Pectin lyase-like superfamily protein (.1) Lus10009605 [exp] 98 / 5e-25 AT3G07840 317 / 1e-102 Pectin lyase-like superfamily protein (.1) Lus10003001 [exp] 97 / 6e-25 AT3G07840 362 / 1e-118 Pectin lyase-like superfamily protein (.1) Lus10041058 [exp] 93 / 2e-23 AT3G07830 311 / 1e-102 Pectin lyase-like superfamily protein (.1) Lus10041059 [exp] 93 / 2e-23 AT3G07830 310 / 1e-102 Pectin lyase-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G035800 [exp] 106 / 1e-28 AT3G07820 350 / 7e-119 Pectin lyase-like superfamily protein (.1) Potri.019G067166 [exp] 97 / 4e-25 AT3G07820 400 / 3e-138 Pectin lyase-like superfamily protein (.1) Potri.019G067200 [exp] 97 / 4e-25 AT3G07820 400 / 3e-138 Pectin lyase-like superfamily protein (.1) Potri.019G067133 [exp] 97 / 4e-25 AT3G07820 400 / 3e-138 Pectin lyase-like superfamily protein (.1) Potri.019G066800 [exp] 96 / 1e-24 AT3G07820 399 / 5e-138 Pectin lyase-like superfamily protein (.1) Potri.019G067000 [exp] 96 / 1e-24 AT3G07820 399 / 5e-138 Pectin lyase-like superfamily protein (.1) Potri.019G067050 [exp] 96 / 1e-24 AT3G07820 399 / 5e-138 Pectin lyase-like superfamily protein (.1) Potri.019G067100 [exp] 95 / 1e-24 AT3G07820 404 / 5e-140 Pectin lyase-like superfamily protein (.1) Potri.009G038100 [exp] 89 / 3e-22 AT1G78400 357 / 4e-121 Pectin lyase-like superfamily protein (.1) Potri.009G169100 [exp] 85 / 1e-20 AT4G18180 563 / 0.0 Pectin lyase-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0268 [flax] [poplar] Pec_lyase-like PF00295 [flax] [poplar] Glyco_hydro_28 Glycosyl hydrolases family 28
Representative CDS sequence Show only first row Show all	>Lus10038316 pacid=23158164 polypeptide=Lus10038316 locus=Lus10038316.g ID=Lus10038316.BGIv1.0 annot-version=v1.0 ATGGCGTCAGGGTCAAGTTGGCCAGATCTGCACCCCGGAGAAGCTACGAACGTGCATTTCGAAGATATCATAATGAACAACGTTAGCAACCCGATAATCA TCGATCAGACTTATTTCCCCGGGCATACATGCGGTCCAAACAGGATCAGTTCCAAAGTCGAGATCAGCAACGTGGTATTCAAAAACATCAAAGGAACATC GAAATTCGAAGTGGCGGTTTTCATGAACTGCAGCCAACTGATCCCCTGCGACAATATACAGATGTCGGATATCGATCTAACCTTACGCGAAAGGAGCTGC TAA
AA sequence Show only first row Show all	>Lus10038316 pacid=23158164 polypeptide=Lus10038316 locus=Lus10038316.g ID=Lus10038316.BGIv1.0 annot-version=v1.0 MASGSSWPDLHPGEATNVHFEDIIMNNVSNPIIIDQTYFPGHTCGPNRISSKVEISNVVFKNIKGTSKFEVAVFMNCSQLIPCDNIQMSDIDLTLRERSC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G14040			Pectin lyase-like superfamily ...		Lus10038316 [exp]	0	1
					Lus10022857 [exp]	1.0	0.8321
AT5G07480		KUOX1	KAR-UP oxidoreductase 1 (.1)		Lus10043000 [exp]	9.5	0.7823
AT3G23230	AP2_ERF	ERF98	Integrase-type DNA-binding sup...		Lus10011831 [exp]	11.2	0.7163
AT5G17600			RING/U-box superfamily protein...		Lus10008458 [exp]	12.0	0.7757
AT5G12060			Plant self-incompatibility pro...		Lus10023195 [exp]	13.9	0.7757
AT4G10850		SWEET7, AtSWEET...	Nodulin MtN3 family protein (....		Lus10023047 [exp]	15.5	0.7757
AT2G39770		VTC1, SOZ1, GMP...	VITAMIN C DEFECTIVE 1, SENSITI...		Lus10028418 [exp]	17.0	0.7705
AT4G35610	C2H2ZnF		zinc finger (C2H2 type) family...		Lus10035994 [exp]	17.1	0.7731
AT3G08710		TRXH9, ATH9	THIOREDOXIN TYPE H 9, thioredo...		Lus10030505 [exp]	18.3	0.7720
AT3G62770		ATATG18A	autophagy 18a, Transducin/WD40...		Lus10023022 [exp]	20.8	0.7704

Compare expression of checked genes

Lus10038316 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.