Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37550 150 / 4e-44 ASP1, AGD7 yeast pde1 suppressor 1, ARF-GAP domain 7 (.1.2) AT3G53710 145 / 6e-42 AGD6 ARF-GAP domain 6 (.1.2) AT4G17890 74 / 3e-16 UBP20, AGD8 ARF-GAP domain 8 (.1.2) AT5G46750 72 / 2e-15 AGD9, AGD8 ARF-GAP domain 9 (.1) AT4G05330 72 / 2e-15 AGD13 ARF-GAP domain 13 (.1) AT2G35210 69 / 2e-14 RPA, AGD10, MEE28 MATERNAL EFFECT EMBRYO ARREST 28, root and pollen arfgap (.1.2) AT4G21160 67 / 9e-14 ZAC, AGD12 ARF-GAP domain 12, Calcium-dependent ARF-type GTPase activating protein family (.1.2.3.4) AT3G07940 56 / 7e-10 Calcium-dependent ARF-type GTPase activating protein family (.1) AT3G17660 55 / 1e-09 AGD15 ARF-GAP domain 15 (.1) AT5G54310 55 / 2e-09 NEV, AGD5 NEVERSHED, ARF-GAP domain 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023765 [exp] 157 / 2e-46 AT2G37550 507 / 4e-178 yeast pde1 suppressor 1, ARF-GAP domain 7 (.1.2) Lus10003978 [exp] 151 / 2e-44 AT2G37550 516 / 0.0 yeast pde1 suppressor 1, ARF-GAP domain 7 (.1.2) Lus10023766 [exp] 145 / 3e-42 AT2G37550 485 / 4e-170 yeast pde1 suppressor 1, ARF-GAP domain 7 (.1.2) Lus10012991 [exp] 79 / 2e-19 AT3G53710 103 / 5e-27 ARF-GAP domain 6 (.1.2) Lus10000903 [exp] 71 / 7e-15 AT4G17890 469 / 3e-165 ARF-GAP domain 8 (.1.2) Lus10004562 [exp] 71 / 8e-15 AT4G17890 512 / 0.0 ARF-GAP domain 8 (.1.2) Lus10004125 [exp] 70 / 9e-15 AT4G17890 283 / 4e-94 ARF-GAP domain 8 (.1.2) Lus10004561 [exp] 67 / 1e-13 AT4G17890 451 / 2e-158 ARF-GAP domain 8 (.1.2) Lus10038539 [exp] 66 / 2e-13 AT4G21160 491 / 4e-176 ARF-GAP domain 12, Calcium-dependent ARF-type GTPase activating protein family (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G084000 [exp] 158 / 6e-47 AT3G53710 498 / 8e-175 ARF-GAP domain 6 (.1.2) Potri.016G095100 [exp] 156 / 4e-46 AT3G53710 462 / 9e-161 ARF-GAP domain 6 (.1.2) Potri.001G142100 [exp] 72 / 2e-15 AT4G17890 535 / 0.0 ARF-GAP domain 8 (.1.2) Potri.003G092300 [exp] 71 / 9e-15 AT4G17890 525 / 0.0 ARF-GAP domain 8 (.1.2) Potri.011G098500 [exp] 67 / 1e-13 AT4G21160 506 / 0.0 ARF-GAP domain 12, Calcium-dependent ARF-type GTPase activating protein family (.1.2.3.4) Potri.001G372000 [exp] 65 / 6e-13 AT4G21160 506 / 0.0 ARF-GAP domain 12, Calcium-dependent ARF-type GTPase activating protein family (.1.2.3.4) Potri.003G198301 [exp] 60 / 4e-11 AT3G07940 503 / 7e-178 Calcium-dependent ARF-type GTPase activating protein family (.1) Potri.T125706 [exp] 60 / 5e-11 AT3G07940 503 / 8e-178 Calcium-dependent ARF-type GTPase activating protein family (.1) Potri.001G026400 [exp] 59 / 6e-11 AT3G07940 211 / 4e-66 Calcium-dependent ARF-type GTPase activating protein family (.1) Potri.011G044100 [exp] 57 / 5e-10 AT5G54310 347 / 3e-115 NEVERSHED, ARF-GAP domain 5 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01412 [flax] [poplar] ArfGap Putative GTPase activating protein for Arf
Representative CDS sequence Show only first row Show all	>Lus10038317 pacid=23158247 polypeptide=Lus10038317 locus=Lus10038317.g ID=Lus10038317.BGIv1.0 annot-version=v1.0 ATGGAGGTACCTCGACGCATCCGGGATCTCCAATCGCAACCTGCAAACCAGATCTGTGCGGACTGCTCCAACAAGTATCCTGATTGGGCCTCCTCCTCTT ATGGCATCTTCATGTGCCTCGACTGCTCTTTCAACCACGGCCGTCTTTCCACCTCCTCGGTCCAATACGTGGACGTGCACCCTTGGTACGACATCCAGAT CAAGAAGATGGAGGTCGGTGGGAACGAAACGCGCAACGCCTTCTTATCTCAGCGAGGGATCCCTAAGGAGACCGATATCCTCGCCAAGTACACCACCAAG GCTGCCGCAGCTTACCGCGACCGGATCCAGGCTTTGGTCGATGGGAAGCCATGGAGTGATCCTCCGGCCACCAAAGAAACGATCGGTGGAAGTAATGATG ATGCGTGTAGATCTTCTGTTGGCATGAGGAGAAGGAGGAATCGTATTGTTGATGGGTATGACTGA
AA sequence Show only first row Show all	>Lus10038317 pacid=23158247 polypeptide=Lus10038317 locus=Lus10038317.g ID=Lus10038317.BGIv1.0 annot-version=v1.0 MEVPRRIRDLQSQPANQICADCSNKYPDWASSSYGIFMCLDCSFNHGRLSTSSVQYVDVHPWYDIQIKKMEVGGNETRNAFLSQRGIPKETDILAKYTTK AAAAYRDRIQALVDGKPWSDPPATKETIGGSNDDACRSSVGMRRRRNRIVDGYD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G37550		ASP1, AGD7	yeast pde1 suppressor 1, ARF-G...		Lus10038317 [exp]	0	1
AT4G24690		AtNBR1	Arabidopsis thaliana next to B...		Lus10019471 [exp]	3.3	0.7010
AT3G29390		RIK	RS2-interacting KH protein (.1...		Lus10032979 [exp]	4.9	0.6997
AT5G06410			DNAJ heat shock N-terminal dom...		Lus10033940 [exp]	20.6	0.6385
AT1G47270	TUB	AtTLP6	tubby like protein 6 (.1.2)		Lus10010833 [exp]	27.1	0.6341
AT4G15200		AFH3	formin 3 (.1.2)		Lus10031585 [exp]	30.4	0.5473
AT1G21750		ATPDI5, ATPDIL1...	ARABIDOPSIS THALIANA PROTEIN D...		Lus10015305 [exp]	32.0	0.6265
					Lus10020623 [exp]	41.7	0.5647
AT2G30460			Nucleotide/sugar transporter f...		Lus10008596 [exp]	49.6	0.4856
AT3G62930			Thioredoxin superfamily protei...		Lus10029441 [exp]	54.2	0.5719
AT5G45840			Leucine-rich repeat protein ki...		Lus10025400 [exp]	63.1	0.5396

Compare expression of checked genes

Lus10038317 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.