Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G31335 66 / 4e-16 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036190 [exp] 140 / 1e-45 AT1G31335 67 / 1e-16 unknown protein Lus10040642 [exp] 60 / 2e-13 AT1G31335 44 / 1e-07 unknown protein Lus10018270 [exp] 60 / 4e-12 AT2G40540 652 / 0.0 potassium transporter 2 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G148100 [exp] 87 / 2e-24 AT1G31335 37 / 8e-05 unknown protein Potri.001G082332 [exp] 82 / 2e-22 AT1G31335 / unknown protein Potri.006G127000 [exp] 40 / 7e-06 AT1G31335 41 / 2e-06 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038328 pacid=23158206 polypeptide=Lus10038328 locus=Lus10038328.g ID=Lus10038328.BGIv1.0 annot-version=v1.0 ATGGGGATGGTAGTGGTGATATCGTTGCCCTTCATACTGTTCTCAATTATGCTGGGAGTTGGGTGCTACTTCTTTGGACGATACAAAGGCAGGCAGGACA TTCGCACCAATCCACAAGTGTTCGGAGTGCCTACGCCTCCTCCCGCAGCTGCCTTGAACAAATCTCATCCTCTTTCTTCAGCTGATGATCATGTTATAAA GCCAACTGCAGCTGACAACTTGTCCAATGTCTGA
AA sequence Show only first row Show all	>Lus10038328 pacid=23158206 polypeptide=Lus10038328 locus=Lus10038328.g ID=Lus10038328.BGIv1.0 annot-version=v1.0 MGMVVVISLPFILFSIMLGVGCYFFGRYKGRQDIRTNPQVFGVPTPPPAAALNKSHPLSSADDHVIKPTAADNLSNV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G31335			unknown protein		Lus10038328 [exp]	0	1
AT1G31335			unknown protein		Lus10036190 [exp]	1.4	0.9305
AT3G53730			Histone superfamily protein (....		Lus10004949 [exp]	2.0	0.9282
AT3G15820		ROD1	REDUCED OLEATE DESATURATION 1,...		Lus10035915 [exp]	2.0	0.9419
AT5G57410			Afadin/alpha-actinin-binding p...		Lus10019997 [exp]	4.0	0.9211
AT1G06450			Polynucleotidyl transferase, r...		Lus10008043 [exp]	6.2	0.9090
AT1G08880		HTA5 ,G-H2AX ,G...	histone H2A 5, gamma histone v...		Lus10028044 [exp]	7.1	0.9285
AT3G07800			Thymidine kinase (.1)		Lus10012347 [exp]	7.4	0.9261
AT5G05080		ATUBC22, UBC22	ubiquitin-conjugating enzyme 2...		Lus10027282 [exp]	8.9	0.8524
AT4G03100			Rho GTPase activating protein ...		Lus10024768 [exp]	11.5	0.9227
AT5G16250			unknown protein		Lus10026857 [exp]	12.0	0.9228

Compare expression of checked genes

Lus10038328 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.