Lus10038330 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G23960 92 / 4e-22 ATTPS21 terpene synthase 21 (.1.2)
AT3G14490 69 / 7e-14 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
AT3G14520 67 / 3e-13 AtTPS18 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
AT3G14540 66 / 8e-13 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
AT1G70080 64 / 4e-12 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
AT1G31950 60 / 6e-11 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
AT1G33750 59 / 2e-10 AtTPS22 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
AT3G25810 53 / 2e-08 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
AT4G13280 52 / 2e-08 ATTPS12, TPS12 terpenoid synthase 12 (.1)
AT1G48800 51 / 7e-08 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031590 69 / 8e-14 AT5G23960 378 / 3e-125 terpene synthase 21 (.1.2)
Lus10031589 63 / 5e-12 AT5G23960 318 / 3e-101 terpene synthase 21 (.1.2)
Lus10008611 57 / 5e-10 AT5G23960 348 / 4e-113 terpene synthase 21 (.1.2)
Lus10002660 57 / 7e-10 AT3G14520 310 / 4e-98 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
Lus10042204 54 / 8e-09 AT5G23960 347 / 4e-113 terpene synthase 21 (.1.2)
Lus10042202 54 / 1e-08 AT5G23960 302 / 8e-96 terpene synthase 21 (.1.2)
Lus10040043 50 / 2e-07 AT5G23960 329 / 7e-106 terpene synthase 21 (.1.2)
Lus10006355 49 / 5e-07 AT2G24210 361 / 7e-117 terpene synthase 10 (.1)
Lus10008614 47 / 2e-06 AT5G23960 345 / 1e-112 terpene synthase 21 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G085500 91 / 1e-21 AT5G23960 456 / 1e-155 terpene synthase 21 (.1.2)
Potri.007G074466 85 / 1e-19 AT5G23960 443 / 1e-150 terpene synthase 21 (.1.2)
Potri.007G074400 81 / 2e-18 AT5G23960 441 / 6e-150 terpene synthase 21 (.1.2)
Potri.019G020367 81 / 4e-18 AT5G23960 494 / 7e-171 terpene synthase 21 (.1.2)
Potri.019G016118 77 / 1e-17 AT5G23960 197 / 1e-59 terpene synthase 21 (.1.2)
Potri.011G142800 79 / 2e-17 AT5G23960 405 / 2e-135 terpene synthase 21 (.1.2)
Potri.019G016400 79 / 2e-17 AT5G23960 436 / 5e-148 terpene synthase 21 (.1.2)
Potri.019G016700 78 / 3e-17 AT5G23960 482 / 6e-166 terpene synthase 21 (.1.2)
Potri.015G032100 78 / 5e-17 AT5G23960 444 / 8e-151 terpene synthase 21 (.1.2)
Potri.019G016500 73 / 2e-15 AT5G23960 463 / 6e-159 terpene synthase 21 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0613 Terp_synthase PF03936 Terpene_synth_C Terpene synthase family, metal binding domain
Representative CDS sequence
>Lus10038330 pacid=23158442 polypeptide=Lus10038330 locus=Lus10038330.g ID=Lus10038330.BGIv1.0 annot-version=v1.0
ATGTTGTCCCTCTTGGATGACACCTTCGATAACTTTGGTAGATACGAGGAGGTCCAAATCCTCACCCAAGCCATTCAAAGGTTCGATGAGATCTCTCTCG
AAACCCTGCCGGAGATGATGAAGAAGATTTATCGAGTTATCATTGACTTGTACGACAAAATCGAGGTGGAACTTGAAACAATCGGGCACGCTTTCGCTGT
TGACTATGCCAAGGAAGAGTTGGAGCGAAGCAGGAAACATGTAGCCACATCTGTAGAATGTTACATAAGAGAGCACAATGTGTCTGAGGAAGAAGCCATT
GGAGTCCTGCGGGACGCGATTTCGGAAGTGCGGAAAGATATCGTCGAACGTTGTCAAAAGCCGACTCCGTCGCCGGTGGCCCTCACTGATCGAGTTCTCA
ATTTCGCAAGATCCTTCAATGTGATTTGTCAGAATGGAGATGGCTATACAAATCCCCACCTTTTGAAGTCTCATATTGCTGCATTGTTTGTCAATCCGAT
TCCGCTCTTTTGA
AA sequence
>Lus10038330 pacid=23158442 polypeptide=Lus10038330 locus=Lus10038330.g ID=Lus10038330.BGIv1.0 annot-version=v1.0
MLSLLDDTFDNFGRYEEVQILTQAIQRFDEISLETLPEMMKKIYRVIIDLYDKIEVELETIGHAFAVDYAKEELERSRKHVATSVECYIREHNVSEEEAI
GVLRDAISEVRKDIVERCQKPTPSPVALTDRVLNFARSFNVICQNGDGYTNPHLLKSHIAALFVNPIPLF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G29410 AtTPS25 Terpenoid cyclases/Protein pre... Lus10038330 0 1
AT1G24735 S-adenosyl-L-methionine-depend... Lus10021804 5.5 0.9505
Lus10025095 6.2 0.9485
AT3G47570 Leucine-rich repeat protein ki... Lus10030851 8.7 0.9197
AT5G45650 subtilase family protein (.1) Lus10026062 9.5 0.9482
Lus10021782 11.0 0.9478
AT5G66870 AS2 LBD36, ASL1 LATERAL ORGAN BOUNDARIES DOMAI... Lus10038261 12.2 0.8862
Lus10023587 12.2 0.9478
AT4G14590 EMB2739 embryo defective 2739 (.1) Lus10009705 13.2 0.8913
AT1G74670 GASA6 GA-stimulated Arabidopsis 6, G... Lus10024216 13.4 0.9478
AT3G26950 unknown protein Lus10032011 13.9 0.8621

Lus10038330 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.