Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G45130 337 / 2e-119 ATRAB-F2A, RHA1, AtRab5A, AtRABF2a ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) AT4G19640 333 / 3e-118 ATRAB-F2B, ARA7, Ara-7, AtRABF2b, AtRab5B ARABIDOPSIS RAB GTPASE HOMOLOG F2B, Ras-related small GTP-binding family protein (.1) AT3G54840 223 / 2e-74 ARA6, AtRABF1, Ara-6, AtRab5C Ras-related small GTP-binding family protein (.1.2) AT1G09630 162 / 2e-50 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) AT1G06400 162 / 2e-50 ARA2, AtRABA1a, AtRab11E, Ara-2 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) AT1G16920 161 / 6e-50 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1) AT5G45750 160 / 2e-49 AtRABA1c RAB GTPase homolog A1C (.1) AT4G18800 157 / 2e-48 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1) AT5G60860 156 / 5e-48 AtRABA1f RAB GTPase homolog A1F (.1) AT1G28550 156 / 5e-48 AtRABA1i RAB GTPase homolog A1I (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040625 [exp] 333 / 6e-118 AT5G45130 355 / 6e-127 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10018285 [exp] 333 / 7e-118 AT5G45130 359 / 3e-128 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10034903 [exp] 240 / 6e-81 AT5G45130 258 / 2e-88 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10036196 [exp] 228 / 2e-77 AT5G45130 214 / 2e-72 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Lus10028820 [exp] 227 / 9e-76 AT3G54840 354 / 3e-126 Ras-related small GTP-binding family protein (.1.2) Lus10036198 [exp] 224 / 1e-75 AT4G19640 216 / 8e-73 ARABIDOPSIS RAB GTPASE HOMOLOG F2B, Ras-related small GTP-binding family protein (.1) Lus10017462 [exp] 221 / 2e-71 AT3G54840 349 / 1e-121 Ras-related small GTP-binding family protein (.1.2) Lus10041116 [exp] 159 / 4e-49 AT1G09630 395 / 4e-142 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Lus10020746 [exp] 158 / 1e-48 AT1G06400 375 / 3e-134 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G117800 [exp] 342 / 2e-121 AT5G45130 357 / 1e-127 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.015G113000 [exp] 339 / 3e-120 AT5G45130 339 / 2e-120 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.018G079300 [exp] 270 / 5e-93 AT5G45130 273 / 2e-94 ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1) Potri.003G054900 [exp] 257 / 7e-88 AT4G19640 270 / 4e-93 ARABIDOPSIS RAB GTPASE HOMOLOG F2B, Ras-related small GTP-binding family protein (.1) Potri.008G035800 [exp] 228 / 1e-76 AT3G54840 367 / 3e-131 Ras-related small GTP-binding family protein (.1.2) Potri.010G226300 [exp] 227 / 6e-76 AT3G54840 373 / 7e-134 Ras-related small GTP-binding family protein (.1.2) Potri.003G004100 [exp] 164 / 6e-51 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Potri.010G197200 [exp] 162 / 2e-50 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.019G092500 [exp] 158 / 7e-49 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.011G070300 [exp] 157 / 2e-48 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00071 [flax] [poplar] Ras Ras family
Representative CDS sequence Show only first row Show all	>Lus10038334 pacid=23158234 polypeptide=Lus10038334 locus=Lus10038334.g ID=Lus10038334.BGIv1.0 annot-version=v1.0 ATGGCCACCGCGGGTAACAAGAACATCAACGCCAAATTGGTGCTGCTTGGTGATCCTGGTGCTGGAAAGTCTAGTCTTGTTCTGCGATTTGTCAAAAACC AGTTTGTTGAGTTTCAGGAATCAACAATAGGTGCTGCCTTCTTTTCACAAACATTGGCAGTGACTGATGTCACTGTGAAATTTGAGATCTGGGACACAGC TGGCCAAGAGAGATATCACAGCCTTGCTCCTATGTACTATCGAGGGGCTGCTGCAGCAATTATCGTGTATGACATCACAAATCCGGCTTCATTTGATCGG GCAAAGAAATGGGTACAAGAACTGCAAGCCCAAGGCAATCCAAATATGGTTATGGCTCTGGCTGGGAACAAAGCTGATTTGCTCGATGAAAGGAAAGTAG AAGCTAAGGCAATACAGGAGGCGGAAGTCTATGCACAGGAGAATGGCCTTTTCTTTATGGAAACCTCGGCGAAAACAGCAACGAATGTCAATGACATTTT TCAGGAAATAGCAAAAAGACTACCACGAGTTCAGCCAGCACAGAACCCGTCTACGATGAATCTCACGGATAGACCTGCAGATCGGGCAGCTAGCGCAGCT TGCTGTTCTTCGTAA
AA sequence Show only first row Show all	>Lus10038334 pacid=23158234 polypeptide=Lus10038334 locus=Lus10038334.g ID=Lus10038334.BGIv1.0 annot-version=v1.0 MATAGNKNINAKLVLLGDPGAGKSSLVLRFVKNQFVEFQESTIGAAFFSQTLAVTDVTVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVYDITNPASFDR AKKWVQELQAQGNPNMVMALAGNKADLLDERKVEAKAIQEAEVYAQENGLFFMETSAKTATNVNDIFQEIAKRLPRVQPAQNPSTMNLTDRPADRAASAA CCSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G45130		ATRAB-F2A, RHA1...	ARABIDOPSIS RAB HOMOLOG F2A, R...		Lus10038334 [exp]	0	1
AT5G45130		ATRAB-F2A, RHA1...	ARABIDOPSIS RAB HOMOLOG F2A, R...		Lus10036196 [exp]	1.0	0.9494
AT1G21780			BTB/POZ domain-containing prot...		Lus10042717 [exp]	2.4	0.9202
AT4G19640		ATRAB-F2B, ARA7...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Lus10036198 [exp]	2.8	0.9253
AT2G19830		VPS32, SNF7.2	SNF7 family protein (.1)		Lus10032705 [exp]	2.8	0.9396
AT1G02305			Cysteine proteinases superfami...		Lus10010091 [exp]	3.0	0.9268
AT1G17455		ELF4-L4	ELF4-like 4 (.1.2)		Lus10000408 [exp]	5.3	0.9201
AT1G43130		LCV2	like COV 2 (.1)		Lus10018869 [exp]	5.5	0.9249
AT1G21780			BTB/POZ domain-containing prot...		Lus10029677 [exp]	5.7	0.9192
AT1G45616		AtRLP6	receptor like protein 6 (.1)		Lus10011064 [exp]	6.5	0.9038
AT2G19830		VPS32, SNF7.2	SNF7 family protein (.1)		Lus10012921 [exp]	6.9	0.9052

Compare expression of checked genes

Lus10038334 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.