Lus10038344 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07970 59 / 7e-11 QRT2 QUARTET 2, Pectin lyase-like superfamily protein (.1)
AT5G27530 57 / 2e-10 Pectin lyase-like superfamily protein (.1)
AT1G70500 56 / 8e-10 Pectin lyase-like superfamily protein (.1)
AT2G41850 54 / 2e-09 ADPG2, PGAZAT ARABIDOPSIS DEHISCENCE ZONE POLYGALACTURONASE 2, polygalacturonase abscission zone A. thaliana (.1)
AT2G43890 54 / 3e-09 Pectin lyase-like superfamily protein (.1)
AT4G35670 54 / 3e-09 Pectin lyase-like superfamily protein (.1)
AT1G23460 52 / 1e-08 Pectin lyase-like superfamily protein (.1)
AT1G05660 52 / 2e-08 Pectin lyase-like superfamily protein (.1)
AT2G43870 49 / 2e-07 Pectin lyase-like superfamily protein (.1)
AT5G44830 49 / 2e-07 Pectin lyase-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036205 119 / 1e-34 AT5G27530 178 / 3e-54 Pectin lyase-like superfamily protein (.1)
Lus10014826 65 / 5e-13 AT5G17200 301 / 1e-97 Pectin lyase-like superfamily protein (.1)
Lus10002727 64 / 8e-13 AT3G15720 254 / 9e-81 Pectin lyase-like superfamily protein (.1.2)
Lus10016940 64 / 8e-13 AT5G17200 320 / 6e-106 Pectin lyase-like superfamily protein (.1)
Lus10018302 61 / 5e-12 AT5G17200 242 / 3e-78 Pectin lyase-like superfamily protein (.1)
Lus10040604 61 / 1e-11 AT3G15720 249 / 1e-79 Pectin lyase-like superfamily protein (.1.2)
Lus10032875 60 / 3e-11 AT3G15720 342 / 3e-114 Pectin lyase-like superfamily protein (.1.2)
Lus10029511 58 / 1e-10 AT3G07970 480 / 1e-167 QUARTET 2, Pectin lyase-like superfamily protein (.1)
Lus10040610 57 / 2e-10 AT5G17200 346 / 7e-116 Pectin lyase-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G119700 59 / 4e-11 AT5G17200 356 / 1e-120 Pectin lyase-like superfamily protein (.1)
Potri.008G010700 57 / 2e-10 AT3G59850 454 / 7e-160 Pectin lyase-like superfamily protein (.1)
Potri.018G028700 57 / 2e-10 AT5G27530 362 / 2e-121 Pectin lyase-like superfamily protein (.1)
Potri.001G463000 57 / 3e-10 AT1G23460 634 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.009G060400 57 / 3e-10 AT3G07970 514 / 0.0 QUARTET 2, Pectin lyase-like superfamily protein (.1)
Potri.007G144100 57 / 3e-10 AT2G43870 525 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.006G052700 56 / 6e-10 AT3G07970 449 / 7e-156 QUARTET 2, Pectin lyase-like superfamily protein (.1)
Potri.017G006500 56 / 6e-10 AT2G43890 552 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.006G252900 56 / 9e-10 AT5G44840 297 / 3e-98 Pectin lyase-like superfamily protein (.1)
Potri.011G159801 54 / 9e-10 AT1G23460 290 / 2e-97 Pectin lyase-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Representative CDS sequence
>Lus10038344 pacid=23158113 polypeptide=Lus10038344 locus=Lus10038344.g ID=Lus10038344.BGIv1.0 annot-version=v1.0
ATGGTGGACTCTGGAATGGAGGGATTATTATTAGAAACCATTGTAGTGTTCTTACTGATCATCACTTGTTCATCTTCTGACACACTTGAGAATTACAGTT
CTAATGTGATTGCTTATGGAGCTGTTGGAGATGGCAACACTGGTGGGTTCCGATGTGGAGGAAAAGGGTATGTGAGAACGGTCACCTTTGAGAGGATCAC
ACTCATCGAGGCACGAAACCCAATCATCATCGACCAGAATTACATGATCTGTCATTATGTTCCTGCAGAACCCTCATCAGATGATGAGATCAGTGACGTT
CTGTACCGAGAGGTGCATGGATCTACCACTGACAAGAAAGCTATCATCTTCTTCTGTGGGCAACGGTACAGCAACATACGTCAACATAACCTCCGCAACT
CCTGA
AA sequence
>Lus10038344 pacid=23158113 polypeptide=Lus10038344 locus=Lus10038344.g ID=Lus10038344.BGIv1.0 annot-version=v1.0
MVDSGMEGLLLETIVVFLLIITCSSSDTLENYSSNVIAYGAVGDGNTGGFRCGGKGYVRTVTFERITLIEARNPIIIDQNYMICHYVPAEPSSDDEISDV
LYREVHGSTTDKKAIIFFCGQRYSNIRQHNLRNS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G07970 QRT2 QUARTET 2, Pectin lyase-like s... Lus10038344 0 1
Lus10028295 1.0 0.9928
AT1G50660 unknown protein Lus10002072 2.4 0.9580
Lus10001343 6.3 0.9078
AT3G01910 AT-SO, ATSO, SO... sulfite oxidase (.1.2.3) Lus10032048 9.6 0.8896
AT3G05610 Plant invertase/pectin methyle... Lus10015211 9.8 0.9269
AT5G66930 unknown protein Lus10000838 11.6 0.8468
AT1G76520 Auxin efflux carrier family pr... Lus10013200 12.6 0.9103
AT5G08640 ATFLS1, FLS flavonol synthase 1 (.1.2) Lus10023601 14.4 0.8869
AT5G15110 Pectate lyase family protein (... Lus10013267 15.8 0.6851
AT1G04670 unknown protein Lus10004041 16.2 0.9069

Lus10038344 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.