Lus10038345 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G19830 260 / 1e-88 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT5G13410 71 / 7e-15 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT4G26555 65 / 1e-12 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT3G60370 59 / 1e-10 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT3G10060 59 / 2e-10 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT5G48570 58 / 9e-10 ROF2, ATFKBP65 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1)
AT2G43560 56 / 2e-09 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT1G18170 56 / 3e-09 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT5G05420 52 / 1e-08 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT3G25230 54 / 2e-08 ROF1, ATFKBP62 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036206 286 / 1e-99 AT4G19830 260 / 4e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10040937 77 / 1e-16 AT5G13410 317 / 1e-109 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10009828 76 / 2e-16 AT5G13410 314 / 1e-108 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10031700 70 / 7e-14 AT4G25340 324 / 3e-105 FK506 BINDING PROTEIN 53 (.1.2)
Lus10027129 62 / 2e-11 AT4G26555 246 / 5e-83 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10031121 62 / 4e-11 AT4G25340 335 / 3e-110 FK506 BINDING PROTEIN 53 (.1.2)
Lus10015029 61 / 7e-11 AT4G25340 331 / 8e-110 FK506 BINDING PROTEIN 53 (.1.2)
Lus10038905 58 / 9e-10 AT4G25340 313 / 1e-102 FK506 BINDING PROTEIN 53 (.1.2)
Lus10038954 57 / 1e-09 AT1G18170 193 / 1e-61 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G119800 276 / 5e-95 AT4G19830 270 / 5e-92 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.001G467100 68 / 8e-14 AT4G26555 268 / 3e-92 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.001G068300 66 / 1e-12 AT5G13410 332 / 4e-116 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.012G129200 62 / 4e-11 AT4G25340 344 / 1e-113 FK506 BINDING PROTEIN 53 (.1.2)
Potri.015G130900 60 / 2e-10 AT4G25340 204 / 1e-59 FK506 BINDING PROTEIN 53 (.1.2)
Potri.014G045600 59 / 3e-10 AT3G60370 302 / 3e-104 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.002G248300 56 / 3e-09 AT3G25230 857 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2)
Potri.016G096600 55 / 5e-09 AT3G10060 272 / 6e-93 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.014G149400 54 / 1e-08 AT5G48570 741 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.012G048300 51 / 1e-07 AT1G18170 249 / 3e-83 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0487 FKBP PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence
>Lus10038345 pacid=23158476 polypeptide=Lus10038345 locus=Lus10038345.g ID=Lus10038345.BGIv1.0 annot-version=v1.0
ATGGAGATGAAATGTTTCGCCTGCAGAATATCATCATCCTACACACCGTACAACGTCACCACCGTCTGCCGCGCCGAATTGAAACCACCACCACCAGTCT
CTGCAACTTCTTCAATTCCCCGACGAAAAGCTTTGGCAGCAGCATCCGTGGTGGTATTATCCACCTTGCCGTTTGTTACCGCCAATCCAGCTTCTTCTTC
TTCCTTCTTCGACCTTCCAGATTCCGGTGGCGTCAAGGGCTTGGACCTCCGCGTCGGTACCGGCGCAGTCCCCACCGACGGCGATCAGGTGGCAATACAT
TACTATGGAAGGCTGGGAGCGAAGCAAGGATGGCGATTTGACTCCACTTATGATCACAAGGACTCTAACGGGGAGCCGATTCCTTTTGTTTTCATTCTCG
GTTCTGGAAAAGTGATTTCAGGGATTGAATCAGCCGTTAAATCAATGAAACTAGGAGGGATTCGTCGGATCGTCATTCCACCCTCCCAAGGCTATCAGAA
CACCTCGCAAGAACCTTTACCCCCTAATTTCTTTGATAGGCAGAGGCTGTTCACCACAATCTTCAACCCGACCCGCCTTGCCAATGGAGAAGGATCCACA
CTAGGAACACTCATCTTCGACATCGAGCTCGTCGGCCTAAGGAATTAG
AA sequence
>Lus10038345 pacid=23158476 polypeptide=Lus10038345 locus=Lus10038345.g ID=Lus10038345.BGIv1.0 annot-version=v1.0
MEMKCFACRISSSYTPYNVTTVCRAELKPPPPVSATSSIPRRKALAAASVVVLSTLPFVTANPASSSSFFDLPDSGGVKGLDLRVGTGAVPTDGDQVAIH
YYGRLGAKQGWRFDSTYDHKDSNGEPIPFVFILGSGKVISGIESAVKSMKLGGIRRIVIPPSQGYQNTSQEPLPPNFFDRQRLFTTIFNPTRLANGEGST
LGTLIFDIELVGLRN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G19830 FKBP-like peptidyl-prolyl cis-... Lus10038345 0 1
AT5G07020 proline-rich family protein (.... Lus10024125 9.9 0.8879
AT1G55480 ZKT protein containing PDZ domain,... Lus10010322 16.3 0.8809
AT5G07020 proline-rich family protein (.... Lus10005388 18.4 0.8749
AT1G55480 ZKT protein containing PDZ domain,... Lus10013403 22.8 0.8713
AT5G51110 Transcriptional coactivator/pt... Lus10022731 25.9 0.8697
AT1G74470 Pyridine nucleotide-disulphide... Lus10001642 27.7 0.8654
AT4G32590 2Fe-2S ferredoxin-like superfa... Lus10041038 30.6 0.8620
AT1G23740 AOR alkenal/one oxidoreductase, Ox... Lus10030873 32.3 0.8595
AT3G25805 unknown protein Lus10022435 32.7 0.8598
AT5G17670 alpha/beta-Hydrolases superfam... Lus10005666 34.2 0.8581

Lus10038345 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.