Lus10038346 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G45040 164 / 2e-52 CYTC6A cytochrome c6A, Cytochrome c (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036207 256 / 7e-89 AT5G45040 188 / 5e-62 cytochrome c6A, Cytochrome c (.1)
Lus10036206 40 / 0.0002 AT4G19830 260 / 4e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G121101 180 / 5e-58 AT5G45040 209 / 3e-69 cytochrome c6A, Cytochrome c (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0318 Cytochrome-c PF00034 Cytochrom_C Cytochrome c
Representative CDS sequence
>Lus10038346 pacid=23158340 polypeptide=Lus10038346 locus=Lus10038346.g ID=Lus10038346.BGIv1.0 annot-version=v1.0
ATGTTGATCCTGTCTGCGGCGGTCACGCCCAACAATTCAACCATGCGGTTCAGACAGGTACCTCGAGCTCCGAAGAAGGAGACGACGAAGATAAATATAC
TAACTAGCTTCGCTCCTCCGATCATTGCTGCAATCGTCGCTTTGTCTACCGTCGATGCCGCCCCCGTGTCCGCAACAACAATTGCTGGTGTGGATGTACA
GAGAGGAGCGACATTGTTCAGTCGGAGTTGCATCGGCTGTCACGACGGAGGAGGCAACATCATCAAACCGGTGATTGAAAATGGAGTAGACACTGAAGAC
GCCATCTATCAAATTACCTACTCCGGCAAGGCAAGAATGCCGGGATTTGGAGAGACGTGCAGTCCAAGAGGGCAGTGCACATTTGGGCCTCGTTTGAAGG
ATGAAAAGATTAAGGTGTTGGCCCGGTTCGTAAAGTCGCAGGCCGATCAAGGCTGGCCCAAGCCCAACACCTTCCAACCTAACGAGTAA
AA sequence
>Lus10038346 pacid=23158340 polypeptide=Lus10038346 locus=Lus10038346.g ID=Lus10038346.BGIv1.0 annot-version=v1.0
MLILSAAVTPNNSTMRFRQVPRAPKKETTKINILTSFAPPIIAAIVALSTVDAAPVSATTIAGVDVQRGATLFSRSCIGCHDGGGNIIKPVIENGVDTED
AIYQITYSGKARMPGFGETCSPRGQCTFGPRLKDEKIKVLARFVKSQADQGWPKPNTFQPNE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G45040 CYTC6A cytochrome c6A, Cytochrome c (... Lus10038346 0 1
AT1G21850 SKS8 SKU5 similar 8 (.1) Lus10022648 11.1 0.8468
Lus10034328 15.7 0.8410
AT3G49720 unknown protein Lus10012481 19.2 0.8403
AT1G08510 FATB fatty acyl-ACP thioesterases B... Lus10025763 22.2 0.8403
AT2G23540 GDSL-like Lipase/Acylhydrolase... Lus10005236 24.8 0.8403
AT3G20580 COBL10 COBRA-like protein 10 precurso... Lus10011160 26.8 0.6581
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10017080 27.2 0.8403
AT4G05120 FUR1, ENT3, FLU... FUDR RESISTANT 1, EQUILIBRATIV... Lus10018414 29.3 0.8403
AT5G22450 unknown protein Lus10000530 31.4 0.8403
Lus10003082 33.3 0.8403

Lus10038346 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.