Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G29570 71 / 2e-16 ATPCNA2, PCNA2 A. THALIANA PROLIFERATING CELL NUCLEAR ANTIGEN 2, proliferating cell nuclear antigen 2 (.1) AT1G07370 71 / 2e-16 ATPCNA1, PCNA1 proliferating cellular nuclear antigen 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005874 [exp] 74 / 6e-18 AT2G29570 389 / 3e-138 A. THALIANA PROLIFERATING CELL NUCLEAR ANTIGEN 2, proliferating cell nuclear antigen 2 (.1) Lus10001197 [exp] 68 / 1e-15 AT2G29570 343 / 1e-120 A. THALIANA PROLIFERATING CELL NUCLEAR ANTIGEN 2, proliferating cell nuclear antigen 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G247700 [exp] 71 / 2e-16 AT2G29570 475 / 4e-172 A. THALIANA PROLIFERATING CELL NUCLEAR ANTIGEN 2, proliferating cell nuclear antigen 2 (.1) Potri.009G040900 [exp] 63 / 1e-13 AT2G29570 484 / 9e-176 A. THALIANA PROLIFERATING CELL NUCLEAR ANTIGEN 2, proliferating cell nuclear antigen 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0060 [flax] [poplar] DNA_clamp PF00705 [flax] [poplar] PCNA_N Proliferating cell nuclear antigen, N-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10038359 pacid=23158343 polypeptide=Lus10038359 locus=Lus10038359.g ID=Lus10038359.BGIv1.0 annot-version=v1.0 ATGCTGGAGCTTCGACTAGTGCAGGGATCCCTTCTGAAGAAAGTGGTAGTAGCCATCAAAGACCTTGTCAACGACGCCAACTTCGATTGTTCCCCCACTT CCCTGGCACTCCTAGCCACGGACTCAAGCGTGTTGCCCTTGTCGCTATCCACCTCCGAGCAAAGGGATTCGATCACTTCCGCTGTGACCGCAACATCTCC ATGGGGATGA
AA sequence Show only first row Show all	>Lus10038359 pacid=23158343 polypeptide=Lus10038359 locus=Lus10038359.g ID=Lus10038359.BGIv1.0 annot-version=v1.0 MLELRLVQGSLLKKVVVAIKDLVNDANFDCSPTSLALLATDSSVLPLSLSTSEQRDSITSAVTATSPWG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G29570		ATPCNA2, PCNA2	A. THALIANA PROLIFERATING CELL...		Lus10038359 [exp]	0	1
AT1G56570		PGN	PENTATRICOPEPTIDE REPEAT PROTE...		Lus10019891 [exp]	45.6	0.5753
					Lus10038789 [exp]	102.1	0.5275
AT3G26010			Galactose oxidase/kelch repeat...		Lus10003692 [exp]	162.2	0.5146

Compare expression of checked genes

Lus10038359 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.