Lus10038365 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G31040 129 / 1e-36 PLATZ transcription factor family protein (.1)
AT2G12646 108 / 7e-29 PLATZ transcription factor family protein (.1)
AT3G60670 97 / 1e-24 PLATZ transcription factor family protein (.1)
AT1G43000 84 / 1e-19 PLATZ transcription factor family protein (.1)
AT1G32700 82 / 3e-19 PLATZ transcription factor family protein (.1.2)
AT1G21000 82 / 9e-19 PLATZ transcription factor family protein (.1.2)
AT4G17900 80 / 1e-18 PLATZ transcription factor family protein (.1.2)
AT1G76590 81 / 4e-18 PLATZ transcription factor family protein (.1)
AT2G27930 79 / 6e-18 PLATZ transcription factor family protein (.1)
AT5G46710 75 / 3e-16 PLATZ transcription factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036226 219 / 1e-72 AT1G31040 191 / 3e-61 PLATZ transcription factor family protein (.1)
Lus10008031 107 / 5e-28 AT2G12646 294 / 1e-100 PLATZ transcription factor family protein (.1)
Lus10038103 101 / 6e-26 AT2G12646 289 / 1e-98 PLATZ transcription factor family protein (.1)
Lus10008814 101 / 8e-26 AT2G12646 301 / 4e-103 PLATZ transcription factor family protein (.1)
Lus10009283 100 / 2e-25 AT3G60670 249 / 2e-83 PLATZ transcription factor family protein (.1)
Lus10015881 100 / 2e-25 AT3G60670 251 / 4e-84 PLATZ transcription factor family protein (.1)
Lus10039989 100 / 5e-25 AT2G12646 292 / 3e-99 PLATZ transcription factor family protein (.1)
Lus10004577 88 / 5e-21 AT4G17900 287 / 6e-99 PLATZ transcription factor family protein (.1.2)
Lus10000482 87 / 1e-20 AT4G17900 284 / 2e-97 PLATZ transcription factor family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G159200 148 / 3e-44 AT1G31040 294 / 3e-101 PLATZ transcription factor family protein (.1)
Potri.003G075600 145 / 7e-43 AT1G31040 306 / 1e-105 PLATZ transcription factor family protein (.1)
Potri.006G060500 112 / 2e-30 AT2G12646 321 / 1e-111 PLATZ transcription factor family protein (.1)
Potri.018G116000 109 / 3e-29 AT2G12646 318 / 2e-110 PLATZ transcription factor family protein (.1)
Potri.014G059300 98 / 1e-24 AT3G60670 238 / 6e-79 PLATZ transcription factor family protein (.1)
Potri.002G144900 90 / 9e-22 AT3G60670 250 / 7e-84 PLATZ transcription factor family protein (.1)
Potri.013G078500 86 / 4e-20 AT4G17900 312 / 1e-108 PLATZ transcription factor family protein (.1.2)
Potri.006G119400 85 / 4e-20 AT2G27930 212 / 3e-70 PLATZ transcription factor family protein (.1)
Potri.001G141500 85 / 7e-20 AT4G17900 302 / 5e-105 PLATZ transcription factor family protein (.1.2)
Potri.001G212400 84 / 7e-20 AT2G27930 224 / 6e-75 PLATZ transcription factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04640 PLATZ PLATZ transcription factor
Representative CDS sequence
>Lus10038365 pacid=23158111 polypeptide=Lus10038365 locus=Lus10038365.g ID=Lus10038365.BGIv1.0 annot-version=v1.0
ATGGTTAGTTACTACTACAACTGTTCATCATCATCATCGGCGGCGGCGGCGGCAGAGGAAGAGAGGAGGAGGAGGAGGCCGCCGCCACCGCCGCCTGCAT
GGCTGCAAGGGCTGATCGGGGTGAGGAGATATGTGTACCATGACGTGGTTCGACTGGAAGATCTCGAGAAGCTAATCGACTGCTCCTATATTCAGCCGTA
CACAATAAACAGTGCAAAGGTGATATTTCTGAAGCAAAGACCACAGTCAAGGTCTGGCAAGGCCGCCTCCTCTGCCAGCTTCTGTTCCACTTGTGACAGA
ATGCTCCAGCACAATTTCCATTTCTGCTCTCTCGCTTGCAAGGTGGATCGCATGGTGGAGGAAGGGGAGAACATGGGTTGCATCCCGTTGATGGGCGGCA
GCGAATCGGAGGATATGACGATGATGACTAGTAGTAGTAGTGCTGCATTCTCGGGCTTCGACGAGATGGCTGACGATGAAGGTGGTGGTGGCCATCTCGA
GCCGTCTTATAATTACGATATGGTGGAAGAAGCGGACACGTCGGGATCGGGTGGTGGTGAGAGGCAAAGGAGGAAGAAGAAGAAGAAAGAGGCGGCGGGG
TTGATACAAGCTGGGATCAATGCGCTGTCGTTGAGCAGTAGAAGGAAAGGTGCTCCTCATAGGGCTCCTCTTTCTTAA
AA sequence
>Lus10038365 pacid=23158111 polypeptide=Lus10038365 locus=Lus10038365.g ID=Lus10038365.BGIv1.0 annot-version=v1.0
MVSYYYNCSSSSSAAAAAEEERRRRRPPPPPPAWLQGLIGVRRYVYHDVVRLEDLEKLIDCSYIQPYTINSAKVIFLKQRPQSRSGKAASSASFCSTCDR
MLQHNFHFCSLACKVDRMVEEGENMGCIPLMGGSESEDMTMMTSSSSAAFSGFDEMADDEGGGGHLEPSYNYDMVEEADTSGSGGGERQRRKKKKKEAAG
LIQAGINALSLSSRRKGAPHRAPLS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G31040 PLATZ transcription factor fam... Lus10038365 0 1
Lus10001007 1.7 0.8361
AT5G40380 CRK42 cysteine-rich RLK (RECEPTOR-li... Lus10008764 1.7 0.7974
AT1G50460 ATHKL1, HKL1 hexokinase-like 1 (.1) Lus10005019 4.2 0.7585
AT4G18593 dual specificity protein phosp... Lus10013913 5.7 0.7392
AT2G35658 unknown protein Lus10000594 7.1 0.7079
AT5G04850 VPS60.2 SNF7 family protein (.1.2) Lus10043454 8.2 0.7290
AT2G30620 winged-helix DNA-binding trans... Lus10006561 11.6 0.8038
AT5G13470 unknown protein Lus10005318 12.2 0.7219
AT5G66580 unknown protein Lus10000739 12.6 0.7408
Lus10019329 17.1 0.6936

Lus10038365 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.