Lus10038385 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G44650 162 / 2e-49 Y3IP1, AtCEST Ycf3-interacting protein 1, Arabidopsis thaliana chloroplast protein-enhancing stress tolerance, unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036245 367 / 5e-131 AT5G44650 169 / 4e-52 Ycf3-interacting protein 1, Arabidopsis thaliana chloroplast protein-enhancing stress tolerance, unknown protein
Lus10024729 196 / 9e-62 AT5G44650 217 / 3e-69 Ycf3-interacting protein 1, Arabidopsis thaliana chloroplast protein-enhancing stress tolerance, unknown protein
Lus10008075 171 / 4e-50 AT5G44650 209 / 2e-63 Ycf3-interacting protein 1, Arabidopsis thaliana chloroplast protein-enhancing stress tolerance, unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G074200 197 / 7e-63 AT5G44650 266 / 3e-89 Ycf3-interacting protein 1, Arabidopsis thaliana chloroplast protein-enhancing stress tolerance, unknown protein
PFAM info
Representative CDS sequence
>Lus10038385 pacid=23158372 polypeptide=Lus10038385 locus=Lus10038385.g ID=Lus10038385.BGIv1.0 annot-version=v1.0
ATGGCAACGACTCTATCCTTTCATCTCTCCAAATTCCCAACTTCTTCCTCAGCACCGGTTCCGTCGCCTTACCGGAAACCCCATTTCGTATTCTTACCGG
TAAGAGGATTGGGAATCAGTTGCACGAATTGCGCCACCCGAAGTCGGAGGAACGCCGCCGGGCTGTTGTTGGTCGGTAGAGAGGATGCTGAGCTGCAGGT
TGAAGAAGGGGAAGAAGAATTGCCGCCGTCACCTCAGGACCTCGAAAACATTCAAGAAATCAAAAGGGTGTTGCAGCTGCTTAAAAAGAACAGAGATATG
GATTTCTATGAGGTTAAGTTGACGATATCGATTGAGGACCCAAGGGAAGTGGAGAGGAGGAAGCTTTTCGGCATTGAAGATCCTGATGCTCCTACCAGAG
AAGACCTTGCTGATGCTTTGGAATCAGTCAAGGAGGGCAAGATTCCCGAAAATCGCTCTGCACTTCAAATGCTAGCTGATGAGATGACGAACTGGCCTAA
TTTAGAGATTACCTTGTTGACAATTCGGTTCCATCATGAATCTTGGCCAAAGGTGGAGGCTTTCAAGACGAAGAAGAAACCAACGAAATCCCTTTACGCA
AGAATCACAGACACTGGTGTTGATCTTAAAGAGGCTGCCAAGAGACTAAAATCCGACTGGGATTCAGACCGAGACTAA
AA sequence
>Lus10038385 pacid=23158372 polypeptide=Lus10038385 locus=Lus10038385.g ID=Lus10038385.BGIv1.0 annot-version=v1.0
MATTLSFHLSKFPTSSSAPVPSPYRKPHFVFLPVRGLGISCTNCATRSRRNAAGLLLVGREDAELQVEEGEEELPPSPQDLENIQEIKRVLQLLKKNRDM
DFYEVKLTISIEDPREVERRKLFGIEDPDAPTREDLADALESVKEGKIPENRSALQMLADEMTNWPNLEITLLTIRFHHESWPKVEAFKTKKKPTKSLYA
RITDTGVDLKEAAKRLKSDWDSDRD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G44650 Y3IP1, AtCEST Ycf3-interacting protein 1, Ar... Lus10038385 0 1
AT5G24060 Pentatricopeptide repeat (PPR)... Lus10027532 1.0 0.9561
AT1G27510 Protein of unknown function (D... Lus10027696 1.4 0.9363
AT3G09250 Nuclear transport factor 2 (NT... Lus10022605 2.4 0.9152
AT3G15690 Single hybrid motif superfamil... Lus10023118 2.8 0.9121
AT5G35100 Cyclophilin-like peptidyl-prol... Lus10019578 4.2 0.8866
AT1G72640 NAD(P)-binding Rossmann-fold s... Lus10000373 4.2 0.9016
AT2G38780 unknown protein Lus10019776 4.5 0.9056
AT1G27510 Protein of unknown function (D... Lus10002370 4.6 0.8973
AT2G25840 OVA4 ovule abortion 4, Nucleotidyly... Lus10005494 6.3 0.8833
AT5G35100 Cyclophilin-like peptidyl-prol... Lus10040008 8.1 0.8816

Lus10038385 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.