Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G20150 134 / 3e-43 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036250 [exp] 169 / 1e-56 AT4G20150 135 / 2e-43 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G074901 [exp] 143 / 1e-46 AT4G20150 142 / 3e-46 unknown protein Potri.003G156301 [exp] 143 / 7e-46 AT4G20150 135 / 2e-42 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038391 pacid=23158374 polypeptide=Lus10038391 locus=Lus10038391.g ID=Lus10038391.BGIv1.0 annot-version=v1.0 ATGGCCTGGAGCGCAACGATGATCGGAGCACTGCTGGGATTGGGTACTCAGATGTACTCCAATGCCCTACGGAAGCTCCCTTATATGCGTCATCCGTGGG AGCACGTAGTCGGTATGGGATTAGGGGTGGTGTTTGTGAACCAGCTAGTGAAATGGGACGCTCAGCTACAGGTTGACCTTGACAAGATGCTCGAGAAGGC TAAAGCCGCCAACGAGCGCCGCTACGTGGGTGAGAATTTTCCCTAA
AA sequence Show only first row Show all	>Lus10038391 pacid=23158374 polypeptide=Lus10038391 locus=Lus10038391.g ID=Lus10038391.BGIv1.0 annot-version=v1.0 MAWSATMIGALLGLGTQMYSNALRKLPYMRHPWEHVVGMGLGVVFVNQLVKWDAQLQVDLDKMLEKAKAANERRYVGENFP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G20150			unknown protein		Lus10038391 [exp]	0	1
AT1G23750			Nucleic acid-binding, OB-fold-...		Lus10029155 [exp]	1.0	0.8879
AT1G07170			PHF5-like protein (.1.2.3)		Lus10040654 [exp]	3.9	0.8559
AT4G08580			microfibrillar-associated prot...		Lus10020321 [exp]	4.2	0.8478
AT2G17570			Undecaprenyl pyrophosphate syn...		Lus10002788 [exp]	8.9	0.8393
AT4G26410			Uncharacterised conserved prot...		Lus10013474 [exp]	10.1	0.7577
AT3G59470	FAR1_related		Far-red impaired responsive (F...		Lus10026854 [exp]	10.1	0.8257
AT3G60540			Preprotein translocase Sec, Se...		Lus10037570 [exp]	10.1	0.8670
AT3G03100			NADH:ubiquinone oxidoreductase...		Lus10030358 [exp]	13.2	0.8524
AT3G45020			Ribosomal L18p/L5e family prot...		Lus10016132 [exp]	15.2	0.8374
AT5G20570		HRT1, ROC1, RBX...	REGULATOR OF CULLINS-1, RING-b...		Lus10013153 [exp]	15.8	0.7809

Compare expression of checked genes

Lus10038391 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.