Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001224 [exp] 120 / 3e-36 AT1G30880 38 / 3e-04 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G155400 [exp] 50 / 6e-09 AT1G30880 / unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038397 pacid=23158319 polypeptide=Lus10038397 locus=Lus10038397.g ID=Lus10038397.BGIv1.0 annot-version=v1.0 ATGGGGAAATCCATCCGGTCGAAGCGGGAGAAGAGGCTGAGAGCCATTAGAAGGGACCTTGTCACGCCCTACTACGACAAGAAAGACGAAGCCAAGATCG CCGCCATTGAAGCAGCGCTCGCCGCTCCTAAGCTCGAAGTCAGACCTTCGCCGTTCGCCACCACGTCCATGGATACATCCACCGTCAATATCATCGATAA TACCACCTCAAACGCCAATACTGGAGCTGATGTTGAGATGGCGATTGGCGGGGATGGGGAGACGTCAAAGAAGCCATTGGGGAGAAAGCTTAGGAAGAAA TTGAAGCTTGCCAAGAACAAGCGCGGTGGGAAGAAGGGTAACATCAAGAAGAGACGTTAG
AA sequence Show only first row Show all	>Lus10038397 pacid=23158319 polypeptide=Lus10038397 locus=Lus10038397.g ID=Lus10038397.BGIv1.0 annot-version=v1.0 MGKSIRSKREKRLRAIRRDLVTPYYDKKDEAKIAAIEAALAAPKLEVRPSPFATTSMDTSTVNIIDNTTSNANTGADVEMAIGGDGETSKKPLGRKLRKK LKLAKNKRGGKKGNIKKRR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10038397 [exp]	0	1
AT5G24510			60S acidic ribosomal protein f...		Lus10008943 [exp]	7.9	0.8711
AT3G16780			Ribosomal protein L19e family ...		Lus10037707 [exp]	15.4	0.8633
AT1G07920			GTP binding Elongation factor ...		Lus10026488 [exp]	16.2	0.8317
AT4G26810			SWIB/MDM2 domain superfamily p...		Lus10038799 [exp]	21.6	0.8119
AT5G15750			Alpha-L RNA-binding motif/Ribo...		Lus10001767 [exp]	26.4	0.8576
AT5G20600			unknown protein		Lus10011961 [exp]	30.9	0.8337
AT5G27850			Ribosomal protein L18e/L15 sup...		Lus10041264 [exp]	31.1	0.8482
AT3G62870			Ribosomal protein L7Ae/L30e/S1...		Lus10009322 [exp]	34.6	0.8022
AT2G20490		NOP10, EDA27	EMBRYO SAC DEVELOPMENT ARREST ...		Lus10022910 [exp]	35.1	0.8219
AT2G03590		ATUPS1	ureide permease 1 (.1)		Lus10037074 [exp]	38.1	0.8482

Compare expression of checked genes

Lus10038397 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.