Lus10038398 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G40400 48 / 3e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G64320 48 / 4e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G19890 43 / 0.0001 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT3G25210 42 / 0.0002 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G18020 42 / 0.0002 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G65820 42 / 0.0003 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G29290 40 / 0.001 EMB2076 embryo defective 2076, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G53700 40 / 0.001 MEE40 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001223 433 / 6e-156 AT4G20090 53 / 6e-08 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10037319 47 / 8e-06 AT4G11690 534 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10039056 46 / 1e-05 AT5G64320 832 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10013841 43 / 0.0001 AT5G65560 868 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10015113 43 / 0.0001 AT1G09900 364 / 5e-119 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10015059 42 / 0.0003 AT3G09650 969 / 0.0 HIGH CHLOROPHYLL FLUORESCENCE 152, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10010410 42 / 0.0004 AT5G59900 998 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10026558 42 / 0.0005 AT5G65560 881 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10038974 41 / 0.0006 AT1G74580 911 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G075700 247 / 3e-82 AT4G20090 65 / 7e-12 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G015900 49 / 2e-06 AT5G64320 878 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G050500 47 / 5e-06 AT1G12700 523 / 2e-178 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.016G025600 47 / 6e-06 AT3G22470 426 / 3e-141 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G248100 43 / 9e-05 AT3G25210 506 / 2e-180 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G013300 44 / 0.0001 AT3G53700 1092 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.017G131400 43 / 0.0002 AT1G09680 669 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G045000 43 / 0.0002 AT1G12700 502 / 4e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G050240 41 / 0.0005 AT1G12700 465 / 1e-155 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.008G108300 41 / 0.0005 AT3G16890 771 / 0.0 pentatricopeptide (PPR) domain protein 40 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10038398 pacid=23158280 polypeptide=Lus10038398 locus=Lus10038398.g ID=Lus10038398.BGIv1.0 annot-version=v1.0
ATGAATTCATTGAGGCAGTGCCACCACCTACAATCACTGACCTTCCTTTCGAGATCGATCTGCTTCTCTCCAGTCTTACAGCATGGAGAAACAACAGCCT
CCACCAACACACAACCAACAACGCTCACCAACGAAGAGATAACCAAAATCAACCTCCTAATCCCACGGCTATGCATCGTCTCCAACAACCTCCCCACAGC
AATCCACCTCATAACAACAGCACTCCTCACAAACCCACCTCCAAAGTCCTTATCTTTATCCATCTTCATCCACTCCCTCACCTTAGAGCCTGACATGGCC
AAACCGATGTCACTCCTCACAGTTCTAAGGCACAACCCATCTGCCCATTCTTACCAGAGCCCCATCGCATCATTGCTCATCTCCTCTTACTTGAAAAGGA
ATCGACCCAAAGAGGCGTTGAAAGTGTACCACTGGATGCTTAGGCCTGGCTCTCTTTGTAAAGTGGAGAAGAATGTGTATGGGGTTTTGCTCTATGGGGT
TTGCAAGCTAGGGTTGGCTTTTGAATCCTTGAAGATTTTGAAGGATATGGTTGGTGTTGGGTTGGTACCTGGGGATGGATTGAGGAAGATGGTTGTGAGG
AACTTGCTGTGGGAAGCTAGAGTTACTGAGGCTGTTGACCTTGATGCTGCCTTGAGTGGCTGCTGCATTGATGGTGAGGGTTTTGAGAAATTGATGAGTC
TTTTGGATTCTTTGGCTGAGAATTGGAGAGACTGA
AA sequence
>Lus10038398 pacid=23158280 polypeptide=Lus10038398 locus=Lus10038398.g ID=Lus10038398.BGIv1.0 annot-version=v1.0
MNSLRQCHHLQSLTFLSRSICFSPVLQHGETTASTNTQPTTLTNEEITKINLLIPRLCIVSNNLPTAIHLITTALLTNPPPKSLSLSIFIHSLTLEPDMA
KPMSLLTVLRHNPSAHSYQSPIASLLISSYLKRNRPKEALKVYHWMLRPGSLCKVEKNVYGVLLYGVCKLGLAFESLKILKDMVGVGLVPGDGLRKMVVR
NLLWEARVTEAVDLDAALSGCCIDGEGFEKLMSLLDSLAENWRD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G20090 EMB1025 embryo defective 1025, Pentatr... Lus10038398 0 1
Lus10017305 4.6 0.9604
AT3G20860 ATNEK5 NIMA-related kinase 5 (.1) Lus10031265 4.7 0.9530
AT1G08290 C2H2ZnF WIP3 WIP domain protein 3 (.1) Lus10004887 8.7 0.9483
AT1G72620 alpha/beta-Hydrolases superfam... Lus10019631 11.5 0.9477
AT4G17220 ATMAP70-5 microtubule-associated protein... Lus10038790 13.4 0.9427
AT1G68585 unknown protein Lus10035025 15.3 0.9397
AT2G39530 Uncharacterised protein family... Lus10023416 15.9 0.9401
AT4G22758 unknown protein Lus10006995 16.1 0.9249
AT3G23430 PHO1, ATPHO1 ARABIDOPSIS PHOSPHATE 1, phosp... Lus10021164 16.5 0.9354
AT1G55180 PLDALPHA4, PLDE... phospholipase D alpha 4 (.1) Lus10036361 17.0 0.9476

Lus10038398 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.