Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G44710 121 / 3e-37 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001221 [exp] 170 / 2e-56 AT5G44710 148 / 7e-48 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G155000 [exp] 133 / 7e-42 AT5G44710 113 / 4e-34 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08293 [flax] [poplar] MRP-S33 Mitochondrial ribosomal subunit S27
Representative CDS sequence Show only first row Show all	>Lus10038399 pacid=23158351 polypeptide=Lus10038399 locus=Lus10038399.g ID=Lus10038399.BGIv1.0 annot-version=v1.0 ATGAGCGGCGTCGGCGGAGGATTCCTAAGGAAGCTCCTGGAAACAGCCGTGACCCAAGGAGTTACAGACGCCAGAGCGAAGATATTCGGCCATGTTCTGA ATCCAACAGGCCAGAGATCGCCCCACAAGTTACTCAGGAAGAAGCTCATCGGCGAGAAGGTTGCTGGATGGTACCCTCACGACATCACTAAGGACGACCC TCTCATCATGGCCGCCAAACAACAAGAGCGGCTGTCGAAGCTCGAGATGCTGAAACGTCGAGGGAAAGGTCCTCCTAAGAAGGGCCAAGGAAAGGGTGCT ACCAAGCGTAACAAAAGCAAATAG
AA sequence Show only first row Show all	>Lus10038399 pacid=23158351 polypeptide=Lus10038399 locus=Lus10038399.g ID=Lus10038399.BGIv1.0 annot-version=v1.0 MSGVGGGFLRKLLETAVTQGVTDARAKIFGHVLNPTGQRSPHKLLRKKLIGEKVAGWYPHDITKDDPLIMAAKQQERLSKLEMLKRRGKGPPKKGQGKGA TKRNKSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G44710			unknown protein		Lus10038399 [exp]	0	1
AT2G37860		LCD1	LOWER CELL DENSITY 1, Protein ...		Lus10012657 [exp]	1.4	0.8965
AT3G08000			RNA-binding (RRM/RBD/RNP motif...		Lus10031534 [exp]	1.4	0.8883
AT1G80700			unknown protein		Lus10026096 [exp]	2.4	0.8782
AT4G36910		CBSX1, CDCP2, L...	LOSS OF THE TIMING OF ET AND J...		Lus10041576 [exp]	3.7	0.8776
AT1G32330	HSF	ATHSFA1D	heat shock transcription facto...		Lus10040091 [exp]	4.6	0.8873
AT1G02820			Late embryogenesis abundant 3 ...		Lus10027987 [exp]	4.9	0.8773
AT4G21720			unknown protein		Lus10017512 [exp]	10.1	0.8122
AT1G43580			Sphingomyelin synthetase famil...		Lus10028111 [exp]	10.7	0.8616
AT2G28910		CXIP4	CAX interacting protein 4 (.1)		Lus10005458 [exp]	10.8	0.8726
AT3G10050		OMR1	L-O-methylthreonine resistant ...		Lus10027728 [exp]	13.0	0.8556

Compare expression of checked genes

Lus10038399 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.