Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G61440 56 / 4e-10 S-locus lectin protein kinase family protein (.1) AT1G11340 55 / 1e-09 S-locus lectin protein kinase family protein (.1) AT1G61480 54 / 2e-09 S-locus lectin protein kinase family protein (.1) AT1G61420 53 / 4e-09 S-locus lectin protein kinase family protein (.1) AT1G61370 53 / 7e-09 S-locus lectin protein kinase family protein (.1) AT1G61380 52 / 7e-09 SD1-29 S-domain-1 29 (.1) AT1G61430 52 / 8e-09 S-locus lectin protein kinase family protein (.1) AT4G21390 51 / 2e-08 B120 S-locus lectin protein kinase family protein (.1) AT3G12000 51 / 3e-08 S-locus related protein SLR1, putative (S1) (.1) AT1G11410 50 / 7e-08 S-locus lectin protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023391 [exp] 171 / 1e-50 AT1G11300 520 / 5e-168 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10041680 [exp] 62 / 5e-12 AT1G15520 1646 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10031603 [exp] 61 / 1e-11 AT4G03230 558 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10003099 [exp] 59 / 3e-11 AT5G18470 296 / 4e-97 Curculin-like (mannose-binding) lectin family protein (.1) Lus10006746 [exp] 57 / 3e-10 AT1G11340 836 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10018406 [exp] 56 / 4e-10 AT1G11340 694 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10038556 [exp] 56 / 4e-10 AT4G21380 769 / 0.0 receptor kinase 3 (.1) Lus10031592 [exp] 55 / 2e-09 AT4G03230 351 / 3e-107 S-locus lectin protein kinase family protein (.1) Lus10014813 [exp] 54 / 2e-09 AT4G27290 805 / 0.0 S-locus lectin protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G441400 [exp] 124 / 5e-34 AT3G16030 523 / 1e-174 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Potri.001G437875 [exp] 119 / 3e-33 AT5G18470 157 / 5e-44 Curculin-like (mannose-binding) lectin family protein (.1) Potri.001G441180 [exp] 118 / 4e-32 AT3G16030 274 / 3e-82 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Potri.001G441040 [exp] 112 / 1e-29 AT4G03230 322 / 1e-97 S-locus lectin protein kinase family protein (.1) Potri.001G442200 [exp] 110 / 5e-29 AT3G16030 528 / 5e-176 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Potri.011G125351 [exp] 63 / 1e-12 AT4G27290 748 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G129300 [exp] 61 / 8e-12 AT4G21380 599 / 0.0 receptor kinase 3 (.1) Potri.011G125451 [exp] 58 / 8e-12 AT4G27290 105 / 1e-27 S-locus lectin protein kinase family protein (.1) Potri.001G409300 [exp] 60 / 1e-11 AT4G27290 875 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G128650 [exp] 59 / 2e-11 AT4G27290 225 / 8e-69 S-locus lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01453 [flax] [poplar] B_lectin D-mannose binding lectin
Representative CDS sequence Show only first row Show all	>Lus10038413 pacid=23158318 polypeptide=Lus10038413 locus=Lus10038413.g ID=Lus10038413.BGIv1.0 annot-version=v1.0 ATGAACTCCACCGAAATTCTTCTCTCCAAAAATGGCTTCTTCACTTTAGGCTTCCGCCGCCTATCCAACGCCAACTACCTCGGGATTTGGTACGACAACG ACACCAATTCCGTCTTCTGGATAGCCAATCGCGATTCCCCCATCCCCGACGATTCGGGATCCCTCTCCCTCAACCCCACCGATACTCTAAAGCTCAACTA CTCCGGCGGCGATATCCTCCGTCTCTACTCCCCTTCTTCTTCAACCACTGGATTGATCGCAACGTTAGAAGACACAGGCAATTTCTCCGTTTCCTCCGGT AATACAGGACGACAGCCAGCCTTATGGCAGGTTTCGATTCCCCGACGGATTCCTGGCTGCCAGGGATGA
AA sequence Show only first row Show all	>Lus10038413 pacid=23158318 polypeptide=Lus10038413 locus=Lus10038413.g ID=Lus10038413.BGIv1.0 annot-version=v1.0 MNSTEILLSKNGFFTLGFRRLSNANYLGIWYDNDTNSVFWIANRDSPIPDDSGSLSLNPTDTLKLNYSGGDILRLYSPSSSTTGLIATLEDTGNFSVSSG NTGRQPALWQVSIPRRIPGCQG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G61440			S-locus lectin protein kinase ...		Lus10038413 [exp]	0	1
					Lus10038412 [exp]	1.0	0.8993
AT1G11330			S-locus lectin protein kinase ...		Lus10038411 [exp]	1.4	0.8929
AT1G16260			Wall-associated kinase family ...		Lus10009751 [exp]	4.5	0.7938
					Lus10000834 [exp]	6.0	0.8088
AT3G47570			Leucine-rich repeat protein ki...		Lus10030634 [exp]	14.2	0.8444
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10027322 [exp]	18.8	0.7237
AT5G15110			Pectate lyase family protein (...		Lus10013267 [exp]	20.6	0.6530
AT5G36930			Disease resistance protein (TI...		Lus10026845 [exp]	22.7	0.7555
AT3G15270	SBP	SPL5	squamosa promoter binding prot...		Lus10005548 [exp]	33.8	0.7308
AT5G53130		ATCNGC1, CNGC1	CYCLIC NUCLEOTIDE-GATED CHANNE...		Lus10003396 [exp]	34.6	0.7361

Compare expression of checked genes

Lus10038413 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.