Lus10038415 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G67150 79 / 9e-19 HXXXD-type acyl-transferase family protein (.1)
AT2G39980 69 / 4e-15 HXXXD-type acyl-transferase family protein (.1)
AT3G50270 68 / 4e-15 HXXXD-type acyl-transferase family protein (.1)
AT5G01210 66 / 3e-14 HXXXD-type acyl-transferase family protein (.1)
AT3G50280 65 / 6e-14 HXXXD-type acyl-transferase family protein (.1)
AT5G67160 65 / 7e-14 EPS1 ENHANCED PSEUDOMONAS SUSCEPTIBILTY 1, HXXXD-type acyl-transferase family protein (.1)
AT3G50300 61 / 3e-12 HXXXD-type acyl-transferase family protein (.1)
AT5G38130 57 / 5e-11 HXXXD-type acyl-transferase family protein (.1)
AT5G42830 57 / 7e-11 HXXXD-type acyl-transferase family protein (.1)
AT5G07850 52 / 4e-09 HXXXD-type acyl-transferase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029485 122 / 3e-37 AT5G67150 107 / 1e-27 HXXXD-type acyl-transferase family protein (.1)
Lus10031149 115 / 8e-32 AT3G50280 305 / 3e-99 HXXXD-type acyl-transferase family protein (.1)
Lus10031148 95 / 2e-24 AT5G67150 284 / 5e-91 HXXXD-type acyl-transferase family protein (.1)
Lus10040222 70 / 1e-15 AT2G39980 633 / 0.0 HXXXD-type acyl-transferase family protein (.1)
Lus10028267 70 / 2e-15 AT2G39980 631 / 0.0 HXXXD-type acyl-transferase family protein (.1)
Lus10041591 70 / 2e-15 AT5G67150 347 / 2e-115 HXXXD-type acyl-transferase family protein (.1)
Lus10029492 63 / 3e-14 AT2G39980 92 / 9e-23 HXXXD-type acyl-transferase family protein (.1)
Lus10035519 65 / 7e-14 AT5G01210 520 / 0.0 HXXXD-type acyl-transferase family protein (.1)
Lus10027778 50 / 8e-10 AT5G01210 141 / 6e-42 HXXXD-type acyl-transferase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G057200 85 / 5e-21 AT5G67150 297 / 1e-96 HXXXD-type acyl-transferase family protein (.1)
Potri.003G057001 81 / 1e-19 AT5G67150 275 / 3e-88 HXXXD-type acyl-transferase family protein (.1)
Potri.003G057100 81 / 2e-19 AT3G50280 303 / 4e-99 HXXXD-type acyl-transferase family protein (.1)
Potri.008G065000 74 / 3e-17 AT2G39980 705 / 0.0 HXXXD-type acyl-transferase family protein (.1)
Potri.010G192400 70 / 1e-15 AT2G39980 708 / 0.0 HXXXD-type acyl-transferase family protein (.1)
Potri.016G112400 63 / 4e-13 AT5G01210 614 / 0.0 HXXXD-type acyl-transferase family protein (.1)
Potri.006G097500 63 / 5e-13 AT5G01210 633 / 0.0 HXXXD-type acyl-transferase family protein (.1)
Potri.014G025600 59 / 8e-12 AT5G42830 565 / 0.0 HXXXD-type acyl-transferase family protein (.1)
Potri.014G025550 58 / 2e-11 AT5G42830 579 / 0.0 HXXXD-type acyl-transferase family protein (.1)
Potri.014G025500 56 / 8e-11 AT5G42830 576 / 0.0 HXXXD-type acyl-transferase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0149 CoA-acyltrans PF02458 Transferase Transferase family
Representative CDS sequence
>Lus10038415 pacid=23158470 polypeptide=Lus10038415 locus=Lus10038415.g ID=Lus10038415.BGIv1.0 annot-version=v1.0
ATGAAGGAGAAGGGGCTAGGAGAGGTGGCGGCGGAGATCAACAAGGTAGTGATGGAGTATAAAAACGACGAGAAGGTAAAGGAAGTGGTGGAGTCTTGGA
TTGAGAATCCCCAGATCCCGACTCTCGGAGGGGTGGTGAAGGGCGGAATAGGGCTGAGTAGCTCCCCGAGGTACGACATCTACGGGAACGATTTCGGATG
GGGGAAGCCGGTGGCGGTGAGGAGTGGGGCTGGGAAAAAAGTAGACGGCTAG
AA sequence
>Lus10038415 pacid=23158470 polypeptide=Lus10038415 locus=Lus10038415.g ID=Lus10038415.BGIv1.0 annot-version=v1.0
MKEKGLGEVAAEINKVVMEYKNDEKVKEVVESWIENPQIPTLGGVVKGGIGLSSSPRYDIYGNDFGWGKPVAVRSGAGKKVDG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G67150 HXXXD-type acyl-transferase fa... Lus10038415 0 1
Lus10022643 12.3 0.8196
Lus10002087 14.1 0.8418
AT5G57770 Plant protein of unknown funct... Lus10015501 19.2 0.8278
Lus10003852 20.9 0.8197
AT1G65290 MTACP2 mitochondrial acyl carrier pro... Lus10020221 28.5 0.7838
AT2G35730 Heavy metal transport/detoxifi... Lus10000263 34.0 0.7475
Lus10010684 35.0 0.8147
AT2G42610 LSH10 LIGHT SENSITIVE HYPOCOTYLS 10,... Lus10029838 35.5 0.8092
AT2G39710 Eukaryotic aspartyl protease f... Lus10040279 35.8 0.8090
AT2G42590 GENERALREGULATO... general regulatory factor 9 (.... Lus10001894 43.8 0.7923

Lus10038415 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.