Lus10038417 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G02230 308 / 6e-108 Ribosomal protein L19e family protein (.1)
AT3G16780 306 / 4e-107 Ribosomal protein L19e family protein (.1)
AT1G02780 305 / 1e-106 EMB2386 embryo defective 2386, Ribosomal protein L19e family protein (.1)
AT4G16030 61 / 6e-12 Ribosomal protein L19e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038418 333 / 9e-117 AT3G16780 337 / 3e-118 Ribosomal protein L19e family protein (.1)
Lus10023387 342 / 1e-116 AT3G16780 343 / 1e-116 Ribosomal protein L19e family protein (.1)
Lus10016829 320 / 2e-112 AT3G16780 363 / 2e-129 Ribosomal protein L19e family protein (.1)
Lus10023388 315 / 1e-110 AT3G16780 324 / 2e-114 Ribosomal protein L19e family protein (.1)
Lus10037707 303 / 1e-102 AT3G16780 343 / 8e-118 Ribosomal protein L19e family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G037500 315 / 1e-110 AT1G02780 317 / 2e-111 embryo defective 2386, Ribosomal protein L19e family protein (.1)
Potri.017G140800 315 / 1e-110 AT3G16780 315 / 2e-110 Ribosomal protein L19e family protein (.1)
Potri.015G029500 315 / 2e-110 AT3G16780 309 / 5e-108 Ribosomal protein L19e family protein (.1)
Potri.004G078000 310 / 9e-109 AT1G02780 309 / 4e-108 embryo defective 2386, Ribosomal protein L19e family protein (.1)
Potri.015G037100 231 / 1e-77 AT1G02780 201 / 5e-66 embryo defective 2386, Ribosomal protein L19e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01280 Ribosomal_L19e Ribosomal protein L19e
Representative CDS sequence
>Lus10038417 pacid=23158274 polypeptide=Lus10038417 locus=Lus10038417.g ID=Lus10038417.BGIv1.0 annot-version=v1.0
ATGGTGTCCGTAAAGCTCCAGAAGAGGCTCGCCGCGAGCGTCATGAAGTGCGGCAAGAAGAAGGTCTGGCTCGATCCAAATGAGGTCAACGAAATCTCCA
TGGCCAACTCTCGCCAAAACATCAGGAAGCTTGTCAAGGATGGGTTCATCATCAGGAAGCCAACCAATATCCACTCCCGCTCTCGTGCTCGACGCATGAA
TGAAGCCAAGAAGAAGGGCCGTCATTCTGGTTACGGTAAGAGGAAGGGTACGAGGGAGGCTAGGCTTCCAACAAAGATCCTGTGGATGAGGAGAATGCGA
GTTCTTAGGAGGCTTCTGAGGAAGTATAGGGAAGCAAAGAAGATTGACAGGCACATGTACCATGACATGTACATGAAGTGCAAAGGTAATGTCTTTAAGA
ACAAGCGTGTGCTGATGGAGAGTATTCACAAGTCCAAGGCAGAGAAGGCCAGAGAGAAGACCTTGTCTGATCAGTTCGAGGCTAAGAGGGCCAAGAACAA
GGCTAGCAGGGAAAGGAAACATGCCAGGAGGGAGGAACGATTCGCCCAGGGTCCAGTAGCTATGGAGAAACCTGCTGCTGCTCCAGCCGTTGTTGCACCT
CAAGGAGCATCAAAGAAATCCAAGAAGTGA
AA sequence
>Lus10038417 pacid=23158274 polypeptide=Lus10038417 locus=Lus10038417.g ID=Lus10038417.BGIv1.0 annot-version=v1.0
MVSVKLQKRLAASVMKCGKKKVWLDPNEVNEISMANSRQNIRKLVKDGFIIRKPTNIHSRSRARRMNEAKKKGRHSGYGKRKGTREARLPTKILWMRRMR
VLRRLLRKYREAKKIDRHMYHDMYMKCKGNVFKNKRVLMESIHKSKAEKAREKTLSDQFEAKRAKNKASRERKHARREERFAQGPVAMEKPAAAPAVVAP
QGASKKSKK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G16780 Ribosomal protein L19e family ... Lus10038417 0 1
AT5G28060 Ribosomal protein S24e family ... Lus10000938 2.6 0.9493
AT3G16780 Ribosomal protein L19e family ... Lus10037707 4.2 0.9415
AT3G16780 Ribosomal protein L19e family ... Lus10016829 4.5 0.9417
AT3G06040 Ribosomal protein L12/ ATP-dep... Lus10031180 5.9 0.9143
AT3G53740 Ribosomal protein L36e family ... Lus10016466 6.0 0.9267
AT1G09590 Translation protein SH3-like f... Lus10030607 6.5 0.9492
AT3G46560 TIM9, EMB2474 embryo defective 2474, Tim10/D... Lus10037964 6.7 0.9294
AT5G24510 60S acidic ribosomal protein f... Lus10028876 8.8 0.9385
AT2G44120 Ribosomal protein L30/L7 famil... Lus10004220 10.4 0.9464
AT1G23100 GroES-like family protein (.1) Lus10036055 10.9 0.9034

Lus10038417 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.