Lus10038427 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G51600 42 / 8e-06 LTP5 lipid transfer protein 5 (.1)
AT2G38530 41 / 2e-05 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1)
AT2G18370 39 / 0.0001 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT3G08770 38 / 0.0003 LTP6 lipid transfer protein 6 (.1.2)
AT2G15050 37 / 0.0007 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001635 56 / 7e-11 AT2G18370 37 / 9e-04 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10001431 54 / 2e-10 AT2G18370 37 / 6e-04 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10004067 49 / 3e-08 AT3G51590 51 / 3e-09 lipid transfer protein 12 (.1)
Lus10025234 47 / 2e-07 AT2G38530 118 / 2e-35 cell growth defect factor-3, lipid transfer protein 2 (.1)
Lus10009003 46 / 4e-07 AT3G51590 59 / 5e-12 lipid transfer protein 12 (.1)
Lus10029226 44 / 3e-06 AT5G59310 94 / 3e-26 lipid transfer protein 4 (.1)
Lus10007280 42 / 1e-05 AT5G59310 90 / 2e-24 lipid transfer protein 4 (.1)
Lus10026418 42 / 1e-05 AT5G59320 115 / 2e-34 lipid transfer protein 3 (.1)
Lus10042210 41 / 3e-05 AT5G59320 86 / 6e-23 lipid transfer protein 3 (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10038427 pacid=23158175 polypeptide=Lus10038427 locus=Lus10038427.g ID=Lus10038427.BGIv1.0 annot-version=v1.0
ATGTTCTCCTATCCAACTTCTTACATCGTCGCTTTCATAGCAATCGTTTTCCTCAGCATCGCTAGCGAAGCAGCGGAAGTGCCAGCAAACCCGAACTGTG
ATGCCTACAGAAACGCATCCTTCGGCTGCATCGCCTATGTTACAAGCACGGCGAAAGACACCCCAATCGTCCCCACTATGTGTTGCGATGACCTTAAGAA
GTATGATTCGAAACTCAGAACCTCCGATGAGAAGAGAAGTGCCTGCGTTTGCTCCTCCACCCACTTGGTCAACTCCCCTAGGGTCAACAAGGCGCGACTT
CGTAAGCTTTCCGAGGAGTGTAAGTTTCGGTTCCCGAAATCAGCCTCTGACTGCAACAAATTTAAGTAA
AA sequence
>Lus10038427 pacid=23158175 polypeptide=Lus10038427 locus=Lus10038427.g ID=Lus10038427.BGIv1.0 annot-version=v1.0
MFSYPTSYIVAFIAIVFLSIASEAAEVPANPNCDAYRNASFGCIAYVTSTAKDTPIVPTMCCDDLKKYDSKLRTSDEKRSACVCSSTHLVNSPRVNKARL
RKLSEECKFRFPKSASDCNKFK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G51600 LTP5 lipid transfer protein 5 (.1) Lus10038427 0 1

Lus10038427 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.