Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038430 [exp] 146 / 6e-47 ND 37 / 7e-04 Lus10038429 [exp] 81 / 5e-21 AT2G18370 44 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10019456 [exp] 79 / 3e-20 ND 37 / 0.002 Lus10043307 [exp] 69 / 3e-16 ND 35 / 0.003 Lus10001431 [exp] 47 / 1e-07 AT2G18370 37 / 6e-04 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10001635 [exp] 44 / 2e-06 AT2G18370 37 / 9e-04 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G098000 [exp] 39 / 0.0001 AT5G59310 71 / 9e-17 lipid transfer protein 4 (.1) Potri.001G008500 [exp] 38 / 0.0004 AT2G44290 155 / 6e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038428 pacid=23158456 polypeptide=Lus10038428 locus=Lus10038428.g ID=Lus10038428.BGIv1.0 annot-version=v1.0 ATGAAGAACAACAGCATGACCACCATAACATTCTCTTGTGTCCTGATCATGATTTGCCTAAGCAGCAGCATCAACAACATTGGCACTGAAGCAGCCAGAG TTACGGCCGACTCCGACCCATGCGCTGCTCCTCGAAAGCAAGTCAGCAGCTGCGCCTCGTTTGTGATGGGTCAGAGTACCGACCCATCGCAGCAGTGCTG CACCGACATCAAAGCACTACTAGGCAAATCAAAAGACGAACTCAAACCTACCTGCGGGTGCGTCTCAGCCTATTTGAATGGTGCTAAGGTCGCTACTCTC AGCAGCTTCTGCGGTGCTAAGGATTATATCGATAAATGCAAATAA
AA sequence Show only first row Show all	>Lus10038428 pacid=23158456 polypeptide=Lus10038428 locus=Lus10038428.g ID=Lus10038428.BGIv1.0 annot-version=v1.0 MKNNSMTTITFSCVLIMICLSSSINNIGTEAARVTADSDPCAAPRKQVSSCASFVMGQSTDPSQQCCTDIKALLGKSKDELKPTCGCVSAYLNGAKVATL SSFCGAKDYIDKCK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10038428 [exp]	0	1
AT2G14095			unknown protein		Lus10025500 [exp]	23.1	0.8673
AT4G35160			O-methyltransferase family pro...		Lus10007035 [exp]	24.5	0.8072
AT4G37850	bHLH	bHLH025	basic helix-loop-helix (bHLH) ...		Lus10039640 [exp]	36.2	0.8389
AT3G11480		BSMT1, ATBSMT1	S-adenosyl-L-methionine-depend...		Lus10036550 [exp]	42.3	0.8535
AT1G48410		AGO1	ARGONAUTE 1, Stabilizer of iro...		Lus10023882 [exp]	60.1	0.8204
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10029185 [exp]	84.1	0.8336
					Lus10026417 [exp]	86.7	0.8329
AT5G20630		ATGER3, GLP3A, ...	GERMIN-LIKE PROTEIN 3, ARABIDO...		Lus10037662 [exp]	128.5	0.8112
AT5G06080	AS2	LBD33	LOB domain-containing protein ...		Lus10040274 [exp]	151.2	0.7994
AT5G07990		CYP75B1, D501, ...	TRANSPARENT TESTA 7, CYTOCHROM...		Lus10021620 [exp]	153.8	0.8159

Compare expression of checked genes

Lus10038428 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.