Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18370 43 / 4e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043307 [exp] 132 / 2e-41 ND 35 / 0.003 Lus10019456 [exp] 132 / 5e-41 ND 37 / 0.002 Lus10038430 [exp] 58 / 5e-12 ND 37 / 7e-04 Lus10038428 [exp] 55 / 1e-10 ND / Lus10001635 [exp] 37 / 0.0006 AT2G18370 37 / 9e-04 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038429 pacid=23158331 polypeptide=Lus10038429 locus=Lus10038429.g ID=Lus10038429.BGIv1.0 annot-version=v1.0 ATGAAGAACAACAACATCAACAGCATCACCATAACATTCTCTTGTGTCGTGATCATGATTTGCCTAAGCAGCAGCAGCAGCATCAACATTAGTGAAGCAG CCAGACTTCCGACCGATGACTCCTCAAACTGTGTTACTTACCAAATCAAAGTCCCCGACTGCGTCCGCTATTTGGAGAGTAAGGATACCAGCCCGCCTGA GAGCTGCTGCAAACAGCTTAAGAAACTATTAGCCCCAACAGCAGACAAACTCAAACCGGTCTGCGATTGCATCAAACCGGTTTTGAACAGCAATCCTAAG GCTGGTACTATTGTCAAGGATTGCAAGGCTGAGACAGAGTTCTCTAAGTGCAACTAA
AA sequence Show only first row Show all	>Lus10038429 pacid=23158331 polypeptide=Lus10038429 locus=Lus10038429.g ID=Lus10038429.BGIv1.0 annot-version=v1.0 MKNNNINSITITFSCVVIMICLSSSSSINISEAARLPTDDSSNCVTYQIKVPDCVRYLESKDTSPPESCCKQLKKLLAPTADKLKPVCDCIKPVLNSNPK AGTIVKDCKAETEFSKCN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G18370			Bifunctional inhibitor/lipid-t...		Lus10038429 [exp]	0	1
AT3G14360			alpha/beta-Hydrolases superfam...		Lus10037465 [exp]	4.2	0.9086
AT2G19900		ATNADP-ME1	Arabidopsis thaliana NADP-mali...		Lus10012964 [exp]	18.5	0.9044
AT1G28330		DYL1, DRM1	DORMANCY-ASSOCIATED PROTEIN 1,...		Lus10015418 [exp]	19.1	0.8991
AT4G08300			nodulin MtN21 /EamA-like trans...		Lus10028030 [exp]	20.4	0.8906
AT4G26400			RING/U-box superfamily protein...		Lus10043027 [exp]	20.4	0.9091
AT5G50260		CEP1	cysteine endopeptidase 1, Cyst...		Lus10013674 [exp]	24.5	0.8963
AT4G28556		RIC7	PAK-box/P21-Rho-binding family...		Lus10008243 [exp]	27.9	0.8509
AT2G24130			Leucine-rich receptor-like pro...		Lus10022180 [exp]	29.4	0.8358
AT3G06860		ATMFP2, ATMPF2,...	multifunctional protein 2 (.1)		Lus10006502 [exp]	32.4	0.8991
AT5G50770		ATHSD6	hydroxysteroid dehydrogenase 6...		Lus10022441 [exp]	38.9	0.8962

Compare expression of checked genes

Lus10038429 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.