Plant FIBer expression Database

Lus10038430 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G05450 38 / 0.0005 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038428
[exp]
156 / 1e-50 ND /
Lus10038429
[exp]
82 / 2e-21 AT2G18370 44 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10019456
[exp]
81 / 6e-21 ND 37 / 0.002
Lus10043307
[exp]
72 / 1e-17 ND 35 / 0.003
Lus10001431
[exp]
42 / 1e-05 AT2G18370 37 / 6e-04 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10001635
[exp]
37 / 0.0005 AT2G18370 37 / 9e-04 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues

No hit found
PFAM info
Representative CDS sequence
>Lus10038430 pacid=23158153 polypeptide=Lus10038430 locus=Lus10038430.g ID=Lus10038430.BGIv1.0 annot-version=v1.0
ATGAAGAACATGAACATGAACATGATAATGTTCTCCTGTGTCCTGATCATGATTTGCCTAAGCAGCAGCATCAACAACATTGGCACTGAAGCAGCCAGAG
TTACGGCCGACTCCGACACATGCGCTGCTCCTCGACAGCAAGTCAGCGGCTGCGCCTCGTTTGTGTTGGGTCGGGTTACCACCCCATCGGACGAGTGCTG
CAACGCCATTAAAGGACTACTAGCCAAATCAAAAGACGAAGTCAAATCTGTCTGCGCGTGCGTCTCACCCTATATGAATGATAAGGCCGAGGCTCTCGCC
GAGTCATGCCATGCTAAGGATGAGGTCGATAAATGCAAATAA
AA sequence
>Lus10038430 pacid=23158153 polypeptide=Lus10038430 locus=Lus10038430.g ID=Lus10038430.BGIv1.0 annot-version=v1.0
MKNMNMNMIMFSCVLIMICLSSSINNIGTEAARVTADSDTCAAPRQQVSGCASFVLGRVTTPSDECCNAIKGLLAKSKDEVKSVCACVSPYMNDKAEALA
ESCHAKDEVDKCK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10038430
[exp]
0 1
AT5G03455 ACR2, ARATH;CDC... ARSENATE REDUCTASE 2, Rhodanes... Lus10014420
[exp]
2.2 0.8914
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Lus10029184
[exp]
3.2 0.8843
AT4G18050 ABCB9, PGP9 ATP-binding cassette B9, P-gly... Lus10004583
[exp]
6.9 0.8337
AT3G04070 NAC ANAC047 NAC domain containing protein ... Lus10021992
[exp]
11.2 0.8305
AT3G50980 XERO1 dehydrin xero 1 (.1) Lus10025983
[exp]
11.4 0.7561
AT4G35150 O-methyltransferase family pro... Lus10033653
[exp]
12.4 0.7518
AT4G04750 Major facilitator superfamily ... Lus10018957
[exp]
14.8 0.8076
AT5G57280 RID2 root initiation defective 2, S... Lus10015533
[exp]
17.5 0.8146
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Lus10014241
[exp]
19.4 0.8030
AT3G12690 AGC1.5 AGC kinase 1.5 (.1.2.3) Lus10001757
[exp]
21.9 0.7879

Lus10038430 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.