Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038438 pacid=23158432 polypeptide=Lus10038438 locus=Lus10038438.g ID=Lus10038438.BGIv1.0 annot-version=v1.0 ATGGCGATGATGATCGAGCCAGCTGTGGCCAGATTCCGTTCCTTCGCAGCTTCAGCTCAAGCACCATTCTACTCAGAATCGATTCAGAACATTACTGCTC CAAGTTGTTGGAGACTAGTGGAGAAATTGCTAGTGGTGTGTCTGCTTATGTTTGCTTATTGTCCGTTAGCTGGTGAGCAAGGATCGAGGCTAACGCTTAT TGGTGGAGACCCGCGGTCCATACAACTCCGTTTGTGGAGTATGTACCTCCGATGGGCACTATGCCCGGCATGA
AA sequence Show only first row Show all	>Lus10038438 pacid=23158432 polypeptide=Lus10038438 locus=Lus10038438.g ID=Lus10038438.BGIv1.0 annot-version=v1.0 MAMMIEPAVARFRSFAASAQAPFYSESIQNITAPSCWRLVEKLLVVCLLMFAYCPLAGEQGSRLTLIGGDPRSIQLRLWSMYLRWALCPA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10038438 [exp]	0	1
AT1G30820			CTP synthase family protein (....		Lus10001218 [exp]	4.8	0.7628
AT3G05950			RmlC-like cupins superfamily p...		Lus10030047 [exp]	10.1	0.6301
AT2G30933			Carbohydrate-binding X8 domain...		Lus10031443 [exp]	17.0	0.6998
AT5G28770	bZIP	BZO2H3, ATBZIP6...	Arabidopsis thaliana basic leu...		Lus10006590 [exp]	19.4	0.7069
AT2G01570	GRAS	RGA1	REPRESSOR OF GA1-3 1, REPRESSO...		Lus10017626 [exp]	19.8	0.6632
AT1G30820			CTP synthase family protein (....		Lus10038403 [exp]	20.7	0.7056
AT1G69040		ACR4	ACT domain repeat 4 (.1.2)		Lus10036827 [exp]	22.0	0.6809
AT1G16560			Per1-like family protein (.1.2...		Lus10038885 [exp]	24.2	0.7152
AT5G23280	TCP	TCP7	TCP family transcription facto...		Lus10010177 [exp]	27.5	0.7038
AT1G72880			Survival protein SurE-like pho...		Lus10008390 [exp]	29.3	0.6952

Compare expression of checked genes

Lus10038438 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.