Lus10038441 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G38940 222 / 6e-74 RmlC-like cupins superfamily protein (.1)
AT3G04200 220 / 4e-73 RmlC-like cupins superfamily protein (.1)
AT5G38960 220 / 5e-73 RmlC-like cupins superfamily protein (.1)
AT3G05950 220 / 6e-73 RmlC-like cupins superfamily protein (.1)
AT5G38930 218 / 4e-72 RmlC-like cupins superfamily protein (.1)
AT5G39110 217 / 5e-72 RmlC-like cupins superfamily protein (.1)
AT5G39120 217 / 8e-72 RmlC-like cupins superfamily protein (.1)
AT5G39130 216 / 1e-71 RmlC-like cupins superfamily protein (.1)
AT4G14630 216 / 1e-71 GLP9 germin-like protein 9 (.1)
AT5G39150 216 / 1e-71 RmlC-like cupins superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023351 329 / 5e-116 AT3G05950 236 / 5e-79 RmlC-like cupins superfamily protein (.1)
Lus10038456 275 / 4e-95 AT3G05950 204 / 9e-67 RmlC-like cupins superfamily protein (.1)
Lus10032016 245 / 5e-83 AT5G39160 264 / 3e-90 RmlC-like cupins superfamily protein (.1.2.3)
Lus10035185 244 / 2e-82 AT5G39160 265 / 2e-90 RmlC-like cupins superfamily protein (.1.2.3)
Lus10035186 243 / 7e-82 AT5G39190 265 / 2e-90 GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2)
Lus10032015 242 / 7e-82 AT5G39160 262 / 3e-89 RmlC-like cupins superfamily protein (.1.2.3)
Lus10035279 241 / 4e-81 AT5G39160 244 / 2e-82 RmlC-like cupins superfamily protein (.1.2.3)
Lus10034254 238 / 2e-80 AT5G39160 251 / 6e-85 RmlC-like cupins superfamily protein (.1.2.3)
Lus10015129 238 / 3e-80 AT5G39130 242 / 2e-81 RmlC-like cupins superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G163200 256 / 2e-87 AT3G05950 266 / 5e-91 RmlC-like cupins superfamily protein (.1)
Potri.011G162932 256 / 2e-87 AT3G05950 268 / 1e-91 RmlC-like cupins superfamily protein (.1)
Potri.001G465100 256 / 3e-87 AT5G39160 253 / 8e-86 RmlC-like cupins superfamily protein (.1.2.3)
Potri.011G163300 254 / 1e-86 AT5G39160 257 / 2e-87 RmlC-like cupins superfamily protein (.1.2.3)
Potri.011G163216 254 / 1e-86 AT5G39160 257 / 2e-87 RmlC-like cupins superfamily protein (.1.2.3)
Potri.011G163800 254 / 1e-86 AT5G39130 255 / 1e-86 RmlC-like cupins superfamily protein (.1)
Potri.019G026400 229 / 2e-76 AT3G05950 288 / 2e-99 RmlC-like cupins superfamily protein (.1)
Potri.019G026500 229 / 2e-76 AT3G05950 288 / 2e-99 RmlC-like cupins superfamily protein (.1)
Potri.019G026000 227 / 9e-76 AT3G05950 288 / 3e-99 RmlC-like cupins superfamily protein (.1)
Potri.019G025900 227 / 9e-76 AT3G05950 288 / 3e-99 RmlC-like cupins superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF00190 Cupin_1 Cupin
Representative CDS sequence
>Lus10038441 pacid=23158375 polypeptide=Lus10038441 locus=Lus10038441.g ID=Lus10038441.BGIv1.0 annot-version=v1.0
ATGGCCGACCAGAGCAACCTCCAAGATTTCTGCGTTGCGGATCCCGATGCTTCAGTCCTGGTCAACGGCATGACATGCAAAGACCCCCAAACGGTCACAT
CCCAAGATTTCTACTTCTCCGGACTTAACACGGCTGGAAACACAACAACCAACCCACAGGGCTCTAGAGTCACGGCCGTAACCGTCAACCAACTCCCCGG
CCTCAACACGTTGGGCGTCTCCATGGCCCGAATCGACTACGCCCCCTCCGGTCAGAACGCCCCCCACATGCACCCACGCGCCACCGAGATGGTGATCGTC
ATCAAAGGAAGCCTCGAGGTCGGATTCGTCACGTCCAACCCGGGCAATGCTCACTACAGGAAGACGTTGGTCCAAGGTGACGTGTTCGTGTTCCCTGCGA
ATTTGGTGCACTACCAACGCAACGTGTTGAACGTGCCGGCTGTTGCTATTGCGGCGTTCTCTAGCCAGAATCCGGGGGTTGTGTCGGTTGCGAATTCGGT
GTTTGGTTCGACTCCGGCGATCCCGGCTGATATTCTTGCTAAGTCTTTCTCCATGGATGTTGACTTTGTCAACTTGTTGCAGTCCAACTTTTGA
AA sequence
>Lus10038441 pacid=23158375 polypeptide=Lus10038441 locus=Lus10038441.g ID=Lus10038441.BGIv1.0 annot-version=v1.0
MADQSNLQDFCVADPDASVLVNGMTCKDPQTVTSQDFYFSGLNTAGNTTTNPQGSRVTAVTVNQLPGLNTLGVSMARIDYAPSGQNAPHMHPRATEMVIV
IKGSLEVGFVTSNPGNAHYRKTLVQGDVFVFPANLVHYQRNVLNVPAVAIAAFSSQNPGVVSVANSVFGSTPAIPADILAKSFSMDVDFVNLLQSNF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G38940 RmlC-like cupins superfamily p... Lus10038441 0 1
AT4G12490 Bifunctional inhibitor/lipid-t... Lus10012763 6.3 0.6309
AT3G47570 Leucine-rich repeat protein ki... Lus10030846 10.7 0.6668
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Lus10029186 11.0 0.6816
AT2G44810 DAD1 DEFECTIVE ANTHER DEHISCENCE 1,... Lus10028210 12.8 0.6388
AT1G06520 ATGPAT1, GPAT1 glycerol-3-phosphate acyltrans... Lus10000071 16.5 0.6320
Lus10006913 22.4 0.5024
AT1G06520 ATGPAT1, GPAT1 glycerol-3-phosphate acyltrans... Lus10000072 22.8 0.6186
AT4G21300 Tetratricopeptide repeat (TPR)... Lus10013405 24.0 0.5424
AT4G01950 ATGPAT3, GPAT3 glycerol-3-phosphate acyltrans... Lus10029839 24.5 0.6109
Lus10021760 28.3 0.5529

Lus10038441 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.