Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023345 [exp] 125 / 1e-34 AT1G07970 736 / 0.0 unknown protein
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04689 [flax] [poplar] S1FA DNA binding protein S1FA
Representative CDS sequence Show only first row Show all	>Lus10038463 pacid=23158189 polypeptide=Lus10038463 locus=Lus10038463.g ID=Lus10038463.BGIv1.0 annot-version=v1.0 ATGGACCTCGACGAGTTCGTCAGCTGGACGCCCGAAAAACCTAAGAGAACTTATTTCATCCGCAATGGACATATGGGGAGGGACAAGAATGGGAAGATGA TCATCAGGGAAAATGAAGACGATGTGCAGAGCAATAGCAGCAGACAAGGTATGGTCGTGTTCGGAATAGTGGTCGGGCTACTGCTTCTCTTTGTAGTCGG CAACTATCTTCTCTACAGTTACGCTACTAGGCAATCGAAGAATAACAAAAAGATGATGATTAAGAAAGCAGTCTCGAAAAAGAAGATGAAGCGGGAAAGG CTCAAACAAGGCATCTTTGTACCTGGAGATTAG
AA sequence Show only first row Show all	>Lus10038463 pacid=23158189 polypeptide=Lus10038463 locus=Lus10038463.g ID=Lus10038463.BGIv1.0 annot-version=v1.0 MDLDEFVSWTPEKPKRTYFIRNGHMGRDKNGKMIIRENEDDVQSNSSRQGMVVFGIVVGLLLLFVVGNYLLYSYATRQSKNNKKMMIKKAVSKKKMKRER LKQGIFVPGD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10038463 [exp]	0	1
AT4G03220			Protein with RNI-like/FBD-like...		Lus10023567 [exp]	2.8	0.9998
AT1G02335		GL22	germin-like protein subfamily ...		Lus10020632 [exp]	3.0	0.9993
AT1G04645			Plant self-incompatibility pro...		Lus10002219 [exp]	4.0	0.9998
					Lus10005830 [exp]	4.9	0.9998
					Lus10009618 [exp]	5.7	0.9998
AT1G75790		SKS18	SKU5 similar 18 (.1)		Lus10013556 [exp]	6.3	0.9998
AT5G59810		ATSBT5.4	Subtilase family protein (.1)		Lus10039085 [exp]	6.9	0.9998
AT2G03220		ATFUT1, ATFT1, ...	MURUS 2, ARABIDOPSIS THALIANA ...		Lus10024077 [exp]	7.5	0.9998
AT5G59810		ATSBT5.4	Subtilase family protein (.1)		Lus10028844 [exp]	8.0	0.9996
					Lus10018225 [exp]	9.5	0.9990

Compare expression of checked genes

Lus10038463 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.