Lus10038474 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G52300 268 / 3e-93 ATPQ "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023337 308 / 3e-109 AT3G52300 298 / 2e-105 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Lus10023492 284 / 2e-99 AT3G52300 295 / 8e-104 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Lus10040374 283 / 2e-99 AT3G52300 293 / 3e-103 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G043800 282 / 9e-99 AT3G52300 291 / 3e-102 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Potri.010G217800 275 / 4e-96 AT3G52300 281 / 1e-98 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05873 Mt_ATP-synt_D ATP synthase D chain, mitochondrial (ATP5H)
Representative CDS sequence
>Lus10038474 pacid=23158187 polypeptide=Lus10038474 locus=Lus10038474.g ID=Lus10038474.BGIv1.0 annot-version=v1.0
ATGAGCGGAGCTGCGAAGAAGGTTACCGATGTGGCGTTCAAGGCTTCCAAGAACATCGATTGGGAAGGCATGGCCAAGCTCATAGTCTCCGACGAGGCTC
GCAAGGAATTCGCCAATCTCCGCCGCGCCTTCGACGAAGTTAACTCTCAACTCCAGACCAAGTTTAGCCAGGAACCCGAACCCATAGACTGGGAATATTA
CCGAAAGGGGATTGGGCCACGCTTGGTTGATATGTACAAGGAAGCATATGAAAGCATTGAGATACCCAAGTATGAAGACAAAGTCACTCCAGAGTACAAA
CCAAAGTTTGATCAACTGATGGTGGAACTGAAAGAAGCAGAGCAAAAGTCTCTGAAAGAATCCGAAAGATTGGAGAAGGAAGTTGCTGAAGTGCAAGAGT
TAAAGAAAAAGATCAGCACAATGACTGCCGATGAGTACTTTGAAAAGCACCCCGAGCTGAAGAAGAAGTTTGACGACGAAATCCGCAATGACTACTGGGG
TTACTGA
AA sequence
>Lus10038474 pacid=23158187 polypeptide=Lus10038474 locus=Lus10038474.g ID=Lus10038474.BGIv1.0 annot-version=v1.0
MSGAAKKVTDVAFKASKNIDWEGMAKLIVSDEARKEFANLRRAFDEVNSQLQTKFSQEPEPIDWEYYRKGIGPRLVDMYKEAYESIEIPKYEDKVTPEYK
PKFDQLMVELKEAEQKSLKESERLEKEVAEVQELKKKISTMTADEYFEKHPELKKKFDDEIRNDYWGY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G52300 ATPQ "ATP synthase D chain, mitocho... Lus10038474 0 1
AT5G47030 ATPase, F1 complex, delta/epsi... Lus10001082 3.2 0.9396
AT1G30890 Integral membrane HRF1 family ... Lus10027039 3.2 0.9278
AT5G40190 RNA ligase/cyclic nucleotide p... Lus10039437 3.7 0.9207
AT1G61150 LisH and RanBPM domains contai... Lus10011219 4.0 0.9178
AT5G36890 BGLU42 beta glucosidase 42 (.1.2) Lus10020232 4.9 0.9207
AT2G02050 NADH-ubiquinone oxidoreductase... Lus10019137 7.7 0.9231
AT3G01280 VDAC1, ATVDAC1 ARABIDOPSIS THALIANA VOLTAGE D... Lus10013271 8.1 0.9245
AT5G06660 Protein of unknown function DU... Lus10029308 10.4 0.9235
AT4G36750 Quinone reductase family prote... Lus10026035 10.5 0.8987
AT5G65270 AtRABA4a RAB GTPase homolog A4A (.1) Lus10000637 14.1 0.8858

Lus10038474 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.