Lus10038479 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G62950 62 / 9e-12 leucine-rich repeat transmembrane protein kinase family protein (.1)
AT5G12940 61 / 1e-11 Leucine-rich repeat (LRR) family protein (.1)
AT5G20480 61 / 1e-11 EFR EF-TU receptor (.1)
AT3G11080 61 / 1e-11 AtRLP35 receptor like protein 35 (.1)
AT3G47570 60 / 4e-11 Leucine-rich repeat protein kinase family protein (.1)
AT1G53440 60 / 4e-11 Leucine-rich repeat transmembrane protein kinase (.1)
AT5G27060 60 / 5e-11 AtRLP53 receptor like protein 53 (.1)
AT5G25930 60 / 5e-11 Protein kinase family protein with leucine-rich repeat domain (.1)
AT5G65710 59 / 6e-11 HSL2 HAESA-like 2 (.1)
AT1G17230 59 / 9e-11 Leucine-rich receptor-like protein kinase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033329 89 / 2e-21 AT3G47570 794 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10033363 84 / 1e-19 AT3G47570 758 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10033330 77 / 6e-17 AT3G47570 783 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10035726 74 / 7e-16 AT3G47570 716 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10033384 74 / 1e-15 AT3G47570 739 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10035725 67 / 1e-13 AT1G54850 132 / 1e-36 HSP20-like chaperones superfamily protein (.1)
Lus10038392 64 / 3e-12 AT4G20140 1376 / 0.0 GASSHO1, Leucine-rich repeat transmembrane protein kinase (.1)
Lus10024681 60 / 3e-12 AT5G20480 82 / 3e-19 EF-TU receptor (.1)
Lus10032306 63 / 5e-12 AT3G47570 792 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G188700 70 / 1e-14 AT5G48940 1011 / 0.0 Leucine-rich repeat transmembrane protein kinase family protein (.1)
Potri.017G151400 69 / 4e-14 AT3G47570 763 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.017G145200 69 / 4e-14 AT3G47570 793 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.012G027600 67 / 1e-13 AT1G71400 395 / 1e-121 receptor like protein 12 (.1)
Potri.017G152500 67 / 2e-13 AT3G47570 753 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.012G010445 66 / 4e-13 AT3G28890 360 / 4e-111 receptor like protein 43 (.1.2)
Potri.016G061500 65 / 9e-13 AT1G53440 577 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1)
Potri.019G058600 64 / 1e-12 AT3G56370 1174 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.002G070900 64 / 2e-12 AT3G24240 1004 / 0.0 Leucine-rich repeat receptor-like protein kinase family protein (.1)
Potri.019G078400 64 / 2e-12 AT1G72180 1060 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1)
PFAM info
Representative CDS sequence
>Lus10038479 pacid=23158451 polypeptide=Lus10038479 locus=Lus10038479.g ID=Lus10038479.BGIv1.0 annot-version=v1.0
ATGCAACTTGGTGGGCACTCTATCTCCGCACATTTCCAATATCACCTTCCTCCAAACCATCAACCTCGTGAACAACAGCTTCCACGGCCATATCCCTCCA
CAAATCGGAAACCTCCGCCACCTCCAGCACTTAACTTATCGACAAACTTCTTCACGAGGCAGATTCCGCCGAACCTCACGCATTGCTTGGACCTCACGAC
AATCCTGGTGGAAGCAAACGGTATCGAAGGAACAATTCCTCAAGATATCGGGCTTTTGTCGAAACCTACACGCTTCAGGATGGCATCCAACTTCCTGACA
GGCCAGCTCCCAACTTCCTTGGAGAACCTGACACAGGTTGTGGAGTTTGCCGTTGCGTCTGATAATCTAGTCGGGGAAATTCCTGAAACAGTCCTTTTCC
CCCGATTCATGTTTCAGGGTATTTATCAACTGGATCAAAGTCTGGTATAA
AA sequence
>Lus10038479 pacid=23158451 polypeptide=Lus10038479 locus=Lus10038479.g ID=Lus10038479.BGIv1.0 annot-version=v1.0
MQLGGHSISAHFQYHLPPNHQPREQQLPRPYPSTNRKPPPPPALNLSTNFFTRQIPPNLTHCLDLTTILVEANGIEGTIPQDIGLLSKPTRFRMASNFLT
GQLPTSLENLTQVVEFAVASDNLVGEIPETVLFPRFMFQGIYQLDQSLV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G34110 Leucine-rich receptor-like pro... Lus10038479 0 1
Lus10011078 9.6 0.9224
Lus10022518 13.6 0.9224
AT2G20420 ATP citrate lyase (ACL) family... Lus10022902 16.6 0.9224
Lus10029072 19.2 0.9224
Lus10003082 21.4 0.9224
AT5G22450 unknown protein Lus10000530 23.5 0.9224
AT4G17220 ATMAP70-5 microtubule-associated protein... Lus10003908 25.4 0.9224
AT1G14000 VIK VH1-interacting kinase (.1) Lus10004066 27.1 0.9224
AT4G27790 Calcium-binding EF hand family... Lus10005911 28.8 0.9224
AT3G63520 ATNCED1, ATCCD1... carotenoid cleavage dioxygenas... Lus10037874 30.3 0.9224

Lus10038479 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.