Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29990 125 / 6e-38 PFD6, PDF6 prefoldin 6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023313 [exp] 137 / 2e-42 AT1G29990 207 / 4e-70 prefoldin 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G131900 [exp] 124 / 1e-37 AT1G29990 213 / 9e-73 prefoldin 6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0200 [flax] [poplar] Prefoldin PF01920 [flax] [poplar] Prefoldin_2 Prefoldin subunit
Representative CDS sequence Show only first row Show all	>Lus10038496 pacid=23158262 polypeptide=Lus10038496 locus=Lus10038496.g ID=Lus10038496.BGIv1.0 annot-version=v1.0 ATGCTGAGAGATATTGCAAAGAATCACCAAGTGCGGAAGAAGTACACTATCCAGCTTGGTGAGAACGAGCTCGTGCTGAAGGAGCTGGAATTGTTGAGAG AGGATGCAAATGTTTTCAAACTGATTGGTCCAGTGCTGGTGAAGCAGGACTTGGCTGAGGCTAATGCCAACGTCCGAAAGAGGATTGAGTATATATCTGC TGAGTTGAAGCGACATGATGCAACTCTTCAAGATCTGGAAGAAAAGCAGAACAGCAAAAGAGAGGCGGTATGTGCTGCACTTTTTCATTCCTACGTTCTG TATATCATAAGCCTTGCTGACACTTTCAGTCCATATATATGCTTCTCTAGTTTGTATCAGTTTTCATCTATTTTTCTTCCCTTATAA
AA sequence Show only first row Show all	>Lus10038496 pacid=23158262 polypeptide=Lus10038496 locus=Lus10038496.g ID=Lus10038496.BGIv1.0 annot-version=v1.0 MLRDIAKNHQVRKKYTIQLGENELVLKELELLREDANVFKLIGPVLVKQDLAEANANVRKRIEYISAELKRHDATLQDLEEKQNSKREAVCAALFHSYVL YIISLADTFSPYICFSSLYQFSSIFLPL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G29990		PFD6, PDF6	prefoldin 6 (.1)		Lus10038496 [exp]	0	1
AT1G61700			RNA polymerases N / 8 kDa subu...		Lus10025907 [exp]	6.2	0.8225
AT3G62810			complex 1 family protein / LVR...		Lus10040570 [exp]	6.2	0.8003
AT3G02080			Ribosomal protein S19e family ...		Lus10032992 [exp]	10.8	0.8641
AT3G25210			Tetratricopeptide repeat (TPR)...		Lus10038215 [exp]	11.0	0.8476
AT5G47570			unknown protein		Lus10000735 [exp]	11.2	0.8465
AT5G59850			Ribosomal protein S8 family pr...		Lus10005960 [exp]	12.7	0.8629
AT1G07170			PHF5-like protein (.1.2.3)		Lus10040654 [exp]	19.3	0.8253
AT2G30942			Protein of unknown function (D...		Lus10007167 [exp]	20.6	0.7923
AT5G59850			Ribosomal protein S8 family pr...		Lus10029461 [exp]	20.7	0.8590
AT5G64140		RPS28	ribosomal protein S28 (.1)		Lus10013543 [exp]	22.4	0.7970

Compare expression of checked genes

Lus10038496 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.