Plant FIBer expression Database

Lus10038502 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G78410 47 / 1e-07 VQ motif-containing protein (.1)
AT1G17147 46 / 1e-07 VQ motif-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023308
[exp]
172 / 7e-57 AT1G78410 55 / 7e-11 VQ motif-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G378300
[exp]
62 / 1e-13 AT1G17147 71 / 2e-17 VQ motif-containing protein (.1)
Potri.011G095900
[exp]
62 / 1e-13 AT1G17147 64 / 1e-14 VQ motif-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Lus10038502 pacid=23158203 polypeptide=Lus10038502 locus=Lus10038502.g ID=Lus10038502.BGIv1.0 annot-version=v1.0
ATGGCGGCATCATCATCAGCAAGCGTCAAGGTGGTGCTAATCGACACCCGGTACGTTGTGACCGAACCGGAGAGCTTCAAGTCGGTGGTCCAGAGACTCA
CCGGCAAGGACTCGTGCGTTTCCTGGATTGAAGAGGCGTCCTTCACCGGCGGCGGCGCCAAGCCTAAGAGGAAGAGGCAGAAGTCTCGGTCTGAGACTTC
TGCCGGAGTTGACGTAAATGTTGACTCGACACCGGCGGCAAAAGTGGGGAGTGGGGAATGGAGGTTGTCGAAAGGGATGTCGTTCAATGATTTGGACAGA
ATGATGCTTGAGATTCCTACGGGTGATGAGCTGCGTCAGTTGTGGAGCAATATCGTATAA
AA sequence
>Lus10038502 pacid=23158203 polypeptide=Lus10038502 locus=Lus10038502.g ID=Lus10038502.BGIv1.0 annot-version=v1.0
MAASSSASVKVVLIDTRYVVTEPESFKSVVQRLTGKDSCVSWIEEASFTGGGAKPKRKRQKSRSETSAGVDVNVDSTPAAKVGSGEWRLSKGMSFNDLDR
MMLEIPTGDELRQLWSNIV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G78410 VQ motif-containing protein (.... Lus10038502
[exp]
0 1
AT4G15690 Thioredoxin superfamily protei... Lus10002887
[exp]
2.2 0.9287
AT2G46495 RING/U-box superfamily protein... Lus10025546
[exp]
3.5 0.9169
AT3G57120 Protein kinase superfamily pro... Lus10011518
[exp]
6.7 0.8903
AT1G02170 AtMCP1b, ATMC1,... LSD ONE LIKE 3, ARABIDOPSIS TH... Lus10015843
[exp]
6.9 0.9113
AT5G18600 Thioredoxin superfamily protei... Lus10033965
[exp]
7.5 0.8908
AT1G76360 Protein kinase superfamily pro... Lus10030742
[exp]
7.7 0.8891
AT5G39020 Malectin/receptor-like protein... Lus10025545
[exp]
8.8 0.9154
AT3G62930 Thioredoxin superfamily protei... Lus10005941
[exp]
9.8 0.8403
AT5G28010 Polyketide cyclase/dehydrase a... Lus10002175
[exp]
9.8 0.8954
AT5G44510 TAO1 target of AVRB operation1 (.1) Lus10011242
[exp]
10.5 0.8256

Lus10038502 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.