Lus10038513 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G46160 207 / 5e-69 Ribosomal protein L14p/L23e family protein (.1.2)
AT1G17560 149 / 5e-46 HLL HUELLENLOS, Ribosomal protein L14p/L23e family protein (.1)
ATCG00780 105 / 2e-29 ATCG00780.1, RPL14 ribosomal protein L14 (.1)
AT3G04400 41 / 7e-05 EMB2171 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
AT2G33370 41 / 7e-05 Ribosomal protein L14p/L23e family protein (.1)
AT1G04480 41 / 7e-05 Ribosomal protein L14p/L23e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023296 248 / 3e-84 AT5G46160 232 / 1e-77 Ribosomal protein L14p/L23e family protein (.1.2)
Lus10022881 42 / 5e-05 AT1G04480 270 / 1e-94 Ribosomal protein L14p/L23e family protein (.1)
Lus10011773 42 / 5e-05 AT2G33370 270 / 2e-94 Ribosomal protein L14p/L23e family protein (.1)
Lus10024943 42 / 8e-05 AT1G04480 270 / 2e-94 Ribosomal protein L14p/L23e family protein (.1)
Lus10012464 41 / 8e-05 AT3G04400 251 / 6e-88 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Lus10020499 41 / 8e-05 AT1G04480 251 / 6e-88 Ribosomal protein L14p/L23e family protein (.1)
Lus10023730 41 / 8e-05 AT2G33370 278 / 3e-98 Ribosomal protein L14p/L23e family protein (.1)
Lus10042695 41 / 9e-05 AT2G33370 273 / 8e-96 Ribosomal protein L14p/L23e family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G022800 213 / 1e-71 AT5G46160 199 / 3e-66 Ribosomal protein L14p/L23e family protein (.1.2)
Potri.003G096525 57 / 5e-11 AT5G46160 62 / 5e-13 Ribosomal protein L14p/L23e family protein (.1.2)
Potri.008G171200 41 / 7e-05 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Potri.010G066400 41 / 7e-05 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Potri.002G257500 41 / 7e-05 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00238 Ribosomal_L14 Ribosomal protein L14p/L23e
Representative CDS sequence
>Lus10038513 pacid=23158410 polypeptide=Lus10038513 locus=Lus10038513.g ID=Lus10038513.BGIv1.0 annot-version=v1.0
ATGGCTGCCAGTTTTGCTTCCAGATGTTCTCGTGCGGGTCGGTCGCTGTTTGGGGGACTCAGCAACAGCATCTCTAGTGCATCAAGCACATCATTTGAGA
TGACTTCCAGCAATTTCCTGTATCAGCTCCAGCAAAACAGGAGTTTCATACAAATGAGGACAGTCCTGAAAGTCGCAGACAACTCTGGTGCGAAAAAGGT
GATGTGCATACAAGTGCTGAAGGGGAAGAAGATAGGGGCTAAGCTAGGGGACACAATCGTGGCTTCGGTGAAAGAAGCGATGCCCAACGGTAAAGTCAAG
AAAGGGAAAGTTGTGTACGGTGTGGTCGTCCGGGCTGCCATGCAGCGTGGACGTTGTGACGGGAGCGAGGTTAAGTTCGACGACAATGCTGTAGTTTTGG
TCGACAAACAAGGCCAGCCGATCGGGACCAGAGTGTTCGGGCCTGTGCCGCACGAGCTCAGACAGAAGAAGCACGTCAAGATCCTTACTCTCGCTGAGCA
TATTGCCTGA
AA sequence
>Lus10038513 pacid=23158410 polypeptide=Lus10038513 locus=Lus10038513.g ID=Lus10038513.BGIv1.0 annot-version=v1.0
MAASFASRCSRAGRSLFGGLSNSISSASSTSFEMTSSNFLYQLQQNRSFIQMRTVLKVADNSGAKKVMCIQVLKGKKIGAKLGDTIVASVKEAMPNGKVK
KGKVVYGVVVRAAMQRGRCDGSEVKFDDNAVVLVDKQGQPIGTRVFGPVPHELRQKKHVKILTLAEHIA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G46160 Ribosomal protein L14p/L23e fa... Lus10038513 0 1
AT3G19130 ATRBP47B RNA-binding protein 47B (.1) Lus10019889 2.6 0.9276
AT1G70190 Ribosomal protein L7/L12, olig... Lus10038367 3.9 0.9258
AT5G35620 eIFiso4E, EIF(I... LOSS OF SUSCEPTIBILITY TO POTY... Lus10023733 5.7 0.9227
AT5G59950 RNA-binding (RRM/RBD/RNP motif... Lus10004946 6.2 0.9033
AT3G61110 ARS27A ribosomal protein S27 (.1) Lus10031979 6.9 0.9268
AT3G18880 Nucleic acid-binding, OB-fold-... Lus10017993 6.9 0.8826
AT5G57370 unknown protein Lus10001311 9.2 0.9134
AT3G59990 MAP2B methionine aminopeptidase 2B (... Lus10005292 11.4 0.8958
AT5G52640 AtHsp90-1, ATHS... HEAT SHOCK PROTEIN 83, HEAT SH... Lus10038845 11.4 0.9206
AT3G12130 C3HZnF KH domain-containing protein /... Lus10012017 12.4 0.9105

Lus10038513 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.