Lus10038514 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G14070 110 / 9e-32 ROXY2 Thioredoxin superfamily protein (.1)
AT3G02000 101 / 2e-28 ROXY1 Thioredoxin superfamily protein (.1)
AT3G21460 100 / 3e-28 Glutaredoxin family protein (.1)
AT1G28480 100 / 1e-27 roxy19, GRX480 Thioredoxin superfamily protein (.1)
AT4G15700 92 / 4e-25 Thioredoxin superfamily protein (.1)
AT3G62950 90 / 3e-24 Thioredoxin superfamily protein (.1)
AT4G15690 90 / 3e-24 Thioredoxin superfamily protein (.1)
AT4G15660 90 / 3e-24 Thioredoxin superfamily protein (.1)
AT4G15670 90 / 3e-24 Thioredoxin superfamily protein (.1)
AT2G47870 89 / 1e-23 Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023295 190 / 3e-63 AT5G14070 123 / 5e-37 Thioredoxin superfamily protein (.1)
Lus10011333 112 / 3e-32 AT5G14070 151 / 1e-47 Thioredoxin superfamily protein (.1)
Lus10041538 111 / 3e-32 AT5G14070 134 / 3e-41 Thioredoxin superfamily protein (.1)
Lus10035183 111 / 4e-32 AT5G14070 148 / 6e-47 Thioredoxin superfamily protein (.1)
Lus10013962 97 / 6e-27 AT1G28480 135 / 3e-42 Thioredoxin superfamily protein (.1)
Lus10039867 94 / 2e-25 AT1G28480 127 / 7e-39 Thioredoxin superfamily protein (.1)
Lus10033965 93 / 2e-25 AT5G18600 148 / 5e-48 Thioredoxin superfamily protein (.1)
Lus10012815 92 / 6e-25 AT3G21460 171 / 3e-57 Glutaredoxin family protein (.1)
Lus10002887 91 / 9e-25 AT4G15690 149 / 3e-48 Thioredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G167000 117 / 1e-34 AT5G14070 150 / 9e-48 Thioredoxin superfamily protein (.1)
Potri.001G060600 114 / 1e-33 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1)
Potri.001G325800 114 / 1e-33 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1)
Potri.017G017300 100 / 1e-27 AT1G28480 132 / 3e-40 Thioredoxin superfamily protein (.1)
Potri.007G134800 100 / 1e-27 AT1G28480 141 / 9e-44 Thioredoxin superfamily protein (.1)
Potri.008G214500 98 / 3e-27 AT3G21460 177 / 2e-59 Glutaredoxin family protein (.1)
Potri.004G049800 94 / 2e-25 AT1G28480 94 / 2e-25 Thioredoxin superfamily protein (.1)
Potri.008G214600 91 / 9e-25 AT5G18600 159 / 2e-52 Thioredoxin superfamily protein (.1)
Potri.010G021800 91 / 1e-24 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1)
Potri.011G058800 91 / 5e-24 AT1G28480 102 / 2e-28 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00462 Glutaredoxin Glutaredoxin
Representative CDS sequence
>Lus10038514 pacid=23158513 polypeptide=Lus10038514 locus=Lus10038514.g ID=Lus10038514.BGIv1.0 annot-version=v1.0
ATGGCGGCGGCAGCGGGAAACGGCGGCGGGTCAACGACAGCCTTGGAGATGGCGGCGGAGAAGAAGAATCACTTTGGCGGCGGGTACGAGGTGGTGAGGG
AGGTGGCGAGGAGCAACGCGGTGGTAGTGTTCAGCATGAGCGGCTGCTGTATGTGCACGGTGGTCAAGCGGCTCCTCTTCGGGCTCGGAGTGGGGCCCAC
GATTGTTGAGCTTGACCACCTCCCTTCTTCCGACGACATCCAGACTGTCCTTTCGCGTCTCCACGGATCCAATAACGGCGGCGGTGGTGGTGGTAGTGGT
ACCGTGCCGGCTGTTTTCATTGGAGGAAAATTTCTCGGTGGGATCGAGACGCTCATGGCTTGCCATATCAATGGGTCCTTGGTGCCTCTCCTCAAGGATG
CTGGTGCTCTCTGGCTTTAA
AA sequence
>Lus10038514 pacid=23158513 polypeptide=Lus10038514 locus=Lus10038514.g ID=Lus10038514.BGIv1.0 annot-version=v1.0
MAAAAGNGGGSTTALEMAAEKKNHFGGGYEVVREVARSNAVVVFSMSGCCMCTVVKRLLFGLGVGPTIVELDHLPSSDDIQTVLSRLHGSNNGGGGGGSG
TVPAVFIGGKFLGGIETLMACHINGSLVPLLKDAGALWL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G14070 ROXY2 Thioredoxin superfamily protei... Lus10038514 0 1
Lus10011249 1.7 0.8848
AT3G29575 AFP3 ABI five binding protein 3 (.1... Lus10022764 4.8 0.7816
AT2G28610 HD PRS1, PRS, WOX3 WUSCHEL RELATED HOMEOBOX 3, PR... Lus10038480 6.2 0.8846
AT1G52340 SIS4, SDR1, ISI... SHORT-CHAIN DEHYDROGENASE REDU... Lus10021319 6.5 0.8663
AT3G09660 MCM8 minichromosome maintenance 8 (... Lus10015060 8.1 0.8024
AT3G50390 Transducin/WD40 repeat-like su... Lus10011699 11.6 0.8298
Lus10041470 12.1 0.7412
AT1G76750 Protein of unknown function (D... Lus10027057 14.0 0.7522
AT2G26580 YABBY YAB5 YABBY5, plant-specific transcr... Lus10030105 14.8 0.8549
AT1G13630 Tetratricopeptide repeat (TPR)... Lus10000029 14.8 0.7340

Lus10038514 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.