Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G30370 98 / 2e-25 DLAH DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1) AT1G06800 60 / 5e-12 PLA-I{gamma}1 phospholipase A I gamma 1, alpha/beta-Hydrolases superfamily protein (.1.2) AT2G30550 60 / 6e-12 alpha/beta-Hydrolases superfamily protein (.1.2) AT1G51440 49 / 3e-08 alpha/beta-Hydrolases superfamily protein (.1) AT2G42690 45 / 1e-06 alpha/beta-Hydrolases superfamily protein (.1) AT2G31100 44 / 3e-06 alpha/beta-Hydrolases superfamily protein (.1) AT1G06250 40 / 4e-05 alpha/beta-Hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038524 [exp] 160 / 5e-49 AT1G30370 526 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1) Lus10015521 [exp] 156 / 1e-47 AT1G30370 524 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1) Lus10038526 [exp] 155 / 4e-46 AT1G30370 539 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1) Lus10023280 [exp] 150 / 3e-44 AT1G30370 537 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1) Lus10000985 [exp] 47 / 3e-07 AT4G18550 375 / 1e-129 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1) Lus10017668 [exp] 44 / 3e-06 AT4G18550 420 / 1e-145 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1) Lus10013935 [exp] 42 / 2e-05 AT4G18550 337 / 2e-113 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1) Lus10017975 [exp] 41 / 4e-05 AT2G42690 524 / 0.0 alpha/beta-Hydrolases superfamily protein (.1) Lus10041967 [exp] 40 / 6e-05 AT2G42690 490 / 3e-173 alpha/beta-Hydrolases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G057900 [exp] 123 / 1e-34 AT1G30370 626 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1) Potri.001G263200 [exp] 121 / 6e-34 AT1G30370 607 / 0.0 DAD1-like acylhydrolase, alpha/beta-Hydrolases superfamily protein (.1) Potri.009G051900 [exp] 63 / 6e-13 AT1G51440 700 / 0.0 alpha/beta-Hydrolases superfamily protein (.1) Potri.005G218500 [exp] 53 / 2e-09 AT1G06800 652 / 0.0 phospholipase A I gamma 1, alpha/beta-Hydrolases superfamily protein (.1.2) Potri.002G044700 [exp] 53 / 2e-09 AT1G06800 662 / 0.0 phospholipase A I gamma 1, alpha/beta-Hydrolases superfamily protein (.1.2) Potri.003G101800 [exp] 50 / 1e-08 AT2G42690 531 / 0.0 alpha/beta-Hydrolases superfamily protein (.1) Potri.004G054600 [exp] 50 / 2e-08 AT4G18550 384 / 1e-131 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1) Potri.015G026500 [exp] 47 / 2e-07 AT4G18550 326 / 5e-109 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1) Potri.004G054800 [exp] 45 / 6e-07 AT4G18550 516 / 0.0 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1) Potri.011G064400 [exp] 44 / 3e-06 AT4G18550 501 / 3e-177 Arabidopsis thaliana DAD1-like seeding establishment-related lipase, alpha/beta-Hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038525 pacid=23158404 polypeptide=Lus10038525 locus=Lus10038525.g ID=Lus10038525.BGIv1.0 annot-version=v1.0 ATGGAGGTGTATCTGCATTTGGTTGATGGGTTCATGAGCAGCAAGTCCAAATTTTGGTGGAATGGGAGGAGGGATTTAGCGTTGGTGAATAAAGATATAA ATATGTTGATCGATGAGCTCAAAATTCCCGAATTCTGGTACGATATGCCGTACAAGAGACTTGTGTTGAACAAGCATGGAAGGTGGGTTAAACCGGGAAG GATGCGTGAAGATGTTCCTACTCCTTTGTTCGGTGATAGTTCCAACCACGAGCCCGTGCTTCAGATTATGGACGACTAA
AA sequence Show only first row Show all	>Lus10038525 pacid=23158404 polypeptide=Lus10038525 locus=Lus10038525.g ID=Lus10038525.BGIv1.0 annot-version=v1.0 MEVYLHLVDGFMSSKSKFWWNGRRDLALVNKDINMLIDELKIPEFWYDMPYKRLVLNKHGRWVKPGRMREDVPTPLFGDSSNHEPVLQIMDD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G30370		DLAH	DAD1-like acylhydrolase, alpha...		Lus10038525 [exp]	0	1
					Lus10021453 [exp]	2.0	0.9137
					Lus10015310 [exp]	2.8	0.9009
AT2G38560		RDO2, TFIIS	REDUCED DORMANCY 2, transcript...		Lus10034247 [exp]	3.9	0.8751
AT4G36950		MAPKKK21	mitogen-activated protein kina...		Lus10034246 [exp]	4.5	0.8884
AT5G58300			Leucine-rich repeat protein ki...		Lus10039483 [exp]	4.7	0.7429
AT5G19730			Pectin lyase-like superfamily ...		Lus10034981 [exp]	5.5	0.8887
AT1G61420			S-locus lectin protein kinase ...		Lus10019600 [exp]	6.9	0.8327
AT5G25250			SPFH/Band 7/PHB domain-contain...		Lus10001944 [exp]	8.0	0.8045
AT5G42790		ARS5, ATPSM30, ...	ARSENIC TOLERANCE 5, proteasom...		Lus10007395 [exp]	11.0	0.7465
AT5G05390		LAC12	laccase 12 (.1)		Lus10040957 [exp]	11.5	0.7501

Compare expression of checked genes

Lus10038525 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.