Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G12870 46 / 2e-06 F-box and associated interaction domains-containing protein (.1) AT3G52320 42 / 3e-05 F-box and associated interaction domains-containing protein (.1) AT2G02030 42 / 4e-05 F-box family protein (.1) AT3G61340 40 / 0.0001 F-box and associated interaction domains-containing protein (.1) AT1G19160 40 / 0.0002 F-box family protein (.1) AT3G23880 39 / 0.0005 F-box and associated interaction domains-containing protein (.1) AT5G62660 39 / 0.0005 F-box and associated interaction domains-containing protein (.1) AT1G47790 39 / 0.0006 F-box and associated interaction domains-containing protein (.1) AT2G33705 36 / 0.0006 F-box family protein (.1) AT1G33530 38 / 0.001 F-box family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006697 [exp] 95 / 9e-24 AT4G12560 80 / 4e-16 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10023263 [exp] 89 / 5e-23 AT3G23880 49 / 6e-07 F-box and associated interaction domains-containing protein (.1) Lus10024389 [exp] 92 / 7e-23 AT4G12560 62 / 1e-10 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10011015 [exp] 84 / 8e-20 AT3G06240 94 / 7e-21 F-box family protein (.1) Lus10007040 [exp] 82 / 2e-19 AT3G06240 86 / 4e-18 F-box family protein (.1) Lus10006687 [exp] 82 / 2e-19 AT4G12560 81 / 5e-17 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10036065 [exp] 50 / 9e-08 AT3G23880 55 / 4e-08 F-box and associated interaction domains-containing protein (.1) Lus10026816 [exp] 49 / 1e-07 AT4G12560 63 / 1e-10 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10013872 [exp] 44 / 7e-06 AT3G06240 101 / 2e-23 F-box family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G318400 [exp] 51 / 2e-08 AT3G06240 142 / 3e-38 F-box family protein (.1) Potri.012G014700 [exp] 51 / 3e-08 AT1G12170 66 / 1e-11 F-box family protein (.1) Potri.008G006900 [exp] 50 / 6e-08 AT4G12560 95 / 3e-21 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.001G458400 [exp] 48 / 3e-07 AT2G31470 113 / 8e-28 DROUGHT TOLERANCE REPRESSOR, F-box and associated interaction domains-containing protein (.1) Potri.012G099733 [exp] 46 / 2e-06 AT3G16210 92 / 2e-20 F-box family protein (.1) Potri.005G114900 [exp] 45 / 3e-06 AT3G21410 73 / 9e-14 F-box and associated interaction domains-containing protein (.1) Potri.017G058900 [exp] 45 / 3e-06 AT3G06240 132 / 2e-34 F-box family protein (.1) Potri.010G154500 [exp] 42 / 3e-05 AT4G12560 139 / 7e-37 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.006G013200 [exp] 42 / 3e-05 AT4G12560 289 / 4e-94 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.015G013500 [exp] 42 / 3e-05 AT4G10190 70 / 4e-13 F-box and associated interaction domains-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0271 [flax] [poplar] F-box PF00646 [flax] [poplar] F-box F-box domain
Representative CDS sequence Show only first row Show all	>Lus10038541 pacid=23158286 polypeptide=Lus10038541 locus=Lus10038541.g ID=Lus10038541.BGIv1.0 annot-version=v1.0 ATGAAGGAAAGAAAGGAAAGGTCGGCTTCTAGAGGCGACGGCGTCGGATTGTCTTCCTTACCGGAGGAAGTGGCGGTGAGCATCTTGGTCAAACTTCCGG TGAAGACTCTGCTACGATTCAAGTACCTCTCCACCGGCATTCACAATCTCATTCGATCGTCATATTTCGTGGCTGCACACGCCGAAGATCAACTCGCGAA TCGTGCCGGAATCTGCCTCCTCACTCATCGGGATATTTATATCTCGGATGATGATGATGGTGCCGCCGGCATTGAGGATAATGATAATAGTACTAACAGC CATGTTTCTTGCTTCTCCTTCCCCTTTCCGATAAACCCTGAGATGTACTCGGTGGATCATGTCTTATCATACTCGAAGATGATGATTGGACTCTAG
AA sequence Show only first row Show all	>Lus10038541 pacid=23158286 polypeptide=Lus10038541 locus=Lus10038541.g ID=Lus10038541.BGIv1.0 annot-version=v1.0 MKERKERSASRGDGVGLSSLPEEVAVSILVKLPVKTLLRFKYLSTGIHNLIRSSYFVAAHAEDQLANRAGICLLTHRDIYISDDDDGAAGIEDNDNSTNS HVSCFSFPFPINPEMYSVDHVLSYSKMMIGL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G52320			F-box and associated interacti...		Lus10038541 [exp]	0	1
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Lus10009535 [exp]	4.0	0.7828
AT1G60200			splicing factor PWI domain-con...		Lus10013003 [exp]	12.2	0.7598
AT3G51070			S-adenosyl-L-methionine-depend...		Lus10028354 [exp]	27.9	0.7812
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Lus10020355 [exp]	32.5	0.7545
AT5G09880			Splicing factor, CC1-like (.1)		Lus10002093 [exp]	36.0	0.7492
AT3G15460			Ribosomal RNA processing Brix ...		Lus10014058 [exp]	62.3	0.7093
AT3G18440		ATALMT9	aluminum-activated malate tran...		Lus10032328 [exp]	63.2	0.7456
AT5G02390		DAU1	DUO1-activated unknown 1, Prot...		Lus10016715 [exp]	66.1	0.7643
AT5G19410		ABCG23	ATP-binding cassette G23, ABC-...		Lus10017683 [exp]	71.5	0.7652
AT5G09880			Splicing factor, CC1-like (.1)		Lus10000826 [exp]	73.5	0.7380

Compare expression of checked genes

Lus10038541 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.