Lus10038555 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G27300 167 / 3e-48 S-locus lectin protein kinase family protein (.1)
AT4G27290 153 / 2e-43 S-locus lectin protein kinase family protein (.1)
AT1G65790 137 / 1e-37 ARK1 receptor kinase 1 (.1)
AT1G65800 137 / 2e-37 ARK2 receptor kinase 2 (.1)
AT4G21380 135 / 5e-37 ARK3 receptor kinase 3 (.1)
AT4G23150 131 / 9e-36 CRK7 cysteine-rich RLK (RECEPTOR-like protein kinase) 7 (.1)
AT4G23200 131 / 9e-36 CRK12 cysteine-rich RLK (RECEPTOR-like protein kinase) 12 (.1)
AT4G23140 130 / 3e-35 RLK5, CRK6 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2)
AT4G23180 129 / 8e-35 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
AT4G03230 129 / 9e-35 S-locus lectin protein kinase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014812 271 / 2e-86 AT4G27290 749 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10038552 191 / 7e-57 AT4G27290 879 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10014810 190 / 7e-57 AT4G27290 692 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10014811 178 / 3e-52 AT4G27290 808 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10038553 176 / 4e-51 AT4G27290 899 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10014813 164 / 3e-47 AT4G27290 805 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10038557 157 / 1e-44 AT4G27290 803 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10037865 156 / 2e-44 AT4G27300 804 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10037731 152 / 2e-43 AT4G27290 644 / 0.0 S-locus lectin protein kinase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G125050 197 / 3e-59 AT4G27290 870 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.001G414000 189 / 4e-56 AT4G27290 766 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.001G413800 185 / 9e-55 AT4G27290 991 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.011G125601 183 / 4e-54 AT4G27290 914 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.001G409300 182 / 1e-53 AT4G27290 875 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.011G128800 181 / 2e-53 AT4G27290 856 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.011G125000 181 / 4e-53 AT4G27290 790 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.001G412000 180 / 5e-53 AT4G27290 815 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.001G414200 180 / 6e-53 AT4G27290 805 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.011G125351 180 / 7e-53 AT4G27290 748 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
CL0016 PF11883 DUF3403 Domain of unknown function (DUF3403)
Representative CDS sequence
>Lus10038555 pacid=23143014 polypeptide=Lus10038555 locus=Lus10038555.g ID=Lus10038555.BGIv1.0 annot-version=v1.0
ATGTCGCAGACATGGAAGTACAGAGTCCATTCGTTGCAGTCTGCTTCGAAGATGCAGCTAGTCACACGGCTAGTTCATGTTCCCACCGGCTGCGGCTACA
TGTCTCCTGAGTATGCCATTGATGGTCTTTTTTCAATGAAATCCGATGTGTATAGTTTTGGGGTTTTGACGCTTGAAATCATTAGTGGGAAGAAGAATAG
AGGATTCAGCCACAAAGATCACAACCTTAACCTTCTTGGTCATGGATGGAGGTTATCGATGGAAGGCAGGCCAATTGAGCTAGCCAGCAATGGTAGGGAT
GAACCCTCCATTATGATTGAAGTACTAAGATGCATTCATGTGGGTCTCCTATGCGTTCAACAAAAACCAGATGACAGGCCAAGCATGTCATCCGTGGTTG
TGATGTTAAGCAGTGATATTCTGCTCCCTCCGCCAAAGCAACCTGGTTTTTTCACAGAGCGGAATGCGCCTGCCACCAAGTTCTCCTCGGATAAGATTTC
TACCTCATCGGTGAACGAAGTTACTATGACACTTCTAGATGCGAGGTAG
AA sequence
>Lus10038555 pacid=23143014 polypeptide=Lus10038555 locus=Lus10038555.g ID=Lus10038555.BGIv1.0 annot-version=v1.0
MSQTWKYRVHSLQSASKMQLVTRLVHVPTGCGYMSPEYAIDGLFSMKSDVYSFGVLTLEIISGKKNRGFSHKDHNLNLLGHGWRLSMEGRPIELASNGRD
EPSIMIEVLRCIHVGLLCVQQKPDDRPSMSSVVVMLSSDILLPPPKQPGFFTERNAPATKFSSDKISTSSVNEVTMTLLDAR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G27300 S-locus lectin protein kinase ... Lus10038555 0 1
AT5G01750 Protein of unknown function (D... Lus10022754 6.0 0.8723
AT1G80320 2-oxoglutarate (2OG) and Fe(II... Lus10041279 6.3 0.8691
AT1G16390 3-Oct, ATOCT3 organic cation/carnitine trans... Lus10005825 11.8 0.8950
AT3G58360 TRAF-like family protein (.1) Lus10012948 19.0 0.8801
AT2G41510 ATCKX1, CKX1 cytokinin oxidase/dehydrogenas... Lus10042035 19.6 0.8466
AT5G19790 AP2_ERF RAP2.11 related to AP2 11 (.1) Lus10010652 21.3 0.8813
AT2G24560 GDSL-like Lipase/Acylhydrolase... Lus10026405 22.7 0.8771
Lus10012313 32.6 0.8579
AT2G47460 MYB PFG1, ATMYB12 PRODUCTION OF FLAVONOL GLYCOSI... Lus10001458 34.6 0.8672
Lus10011947 38.7 0.8244

Lus10038555 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.