Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27360 156 / 5e-51 Dynein light chain type 1 family protein (.1) AT3G16120 108 / 4e-32 Dynein light chain type 1 family protein (.1) AT1G52240 100 / 1e-28 PIRF1, ATROPGEF11, ROPGEF11 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) AT4G15930 82 / 4e-21 Dynein light chain type 1 family protein (.1) AT5G20110 77 / 3e-18 Dynein light chain type 1 family protein (.1) AT1G23220 66 / 4e-15 Dynein light chain type 1 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035868 [exp] 103 / 7e-30 AT1G52240 174 / 2e-58 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10025794 [exp] 100 / 7e-29 AT1G52240 172 / 1e-57 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10011443 [exp] 99 / 4e-28 AT1G52240 164 / 2e-54 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10021496 [exp] 94 / 3e-26 AT1G52240 114 / 2e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10022596 [exp] 94 / 6e-26 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10037551 [exp] 89 / 5e-24 AT1G52240 157 / 2e-51 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10014484 [exp] 73 / 1e-16 AT5G20110 191 / 2e-61 Dynein light chain type 1 family protein (.1) Lus10034609 [exp] 69 / 6e-16 AT1G23220 181 / 4e-60 Dynein light chain type 1 family protein (.1) Lus10030069 [exp] 71 / 7e-16 AT5G20110 201 / 2e-65 Dynein light chain type 1 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G407900 [exp] 161 / 1e-52 AT4G27360 126 / 5e-39 Dynein light chain type 1 family protein (.1) Potri.011G126400 [exp] 159 / 9e-52 AT4G27360 117 / 2e-35 Dynein light chain type 1 family protein (.1) Potri.004G034000 [exp] 152 / 4e-49 AT4G27360 143 / 6e-46 Dynein light chain type 1 family protein (.1) Potri.003G052800 [exp] 100 / 2e-28 AT1G52240 151 / 3e-49 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Potri.006G091800 [exp] 94 / 7e-26 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Potri.001G401400 [exp] 77 / 7e-19 AT1G23220 109 / 2e-31 Dynein light chain type 1 family protein (.1) Potri.008G219900 [exp] 76 / 7e-19 AT4G15930 154 / 1e-49 Dynein light chain type 1 family protein (.1) Potri.011G120400 [exp] 75 / 4e-18 AT1G23220 112 / 1e-32 Dynein light chain type 1 family protein (.1) Potri.008G133000 [exp] 71 / 1e-16 AT1G23220 204 / 3e-69 Dynein light chain type 1 family protein (.1) Potri.003G108700 [exp] 71 / 1e-16 AT5G20110 116 / 4e-33 Dynein light chain type 1 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01221 [flax] [poplar] Dynein_light Dynein light chain type 1
Representative CDS sequence Show only first row Show all	>Lus10038566 pacid=23143015 polypeptide=Lus10038566 locus=Lus10038566.g ID=Lus10038566.BGIv1.0 annot-version=v1.0 ATGCTAGAAGGCAAAGCAGTGGTTGGGGAGACGGACATGCTCCACACCATGCAACAAGATGCTCTGCATCTTGCCGCCAATGCCTTGGATTTCTTCGATG TCACTCAGCCTACTGAGATTGCTCGTTTCATCAAGAAGGAATTTGACAGGGTGTATGGAGGAGGATGGATGTGCATTGTGGGAACTGATTTCGGTTCGTT TGTGACACATTGCTCTGGCTGTTTCATCCATTTCCATATTGGCAGTCTCGCCATTCTCCTCTTCAGGGGATCTGCCGCCGATCCACAACTTGGCCCCACA GCCGACCACGATTTCTCAGTTCTAACCCCTTCAACAAAACCACTCAAATCCTGA
AA sequence Show only first row Show all	>Lus10038566 pacid=23143015 polypeptide=Lus10038566 locus=Lus10038566.g ID=Lus10038566.BGIv1.0 annot-version=v1.0 MLEGKAVVGETDMLHTMQQDALHLAANALDFFDVTQPTEIARFIKKEFDRVYGGGWMCIVGTDFGSFVTHCSGCFIHFHIGSLAILLFRGSAADPQLGPT ADHDFSVLTPSTKPLKS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G27360			Dynein light chain type 1 fami...		Lus10038566 [exp]	0	1
AT5G49740		ATFRO7, FRO7	ferric reduction oxidase 7 (.1...		Lus10012160 [exp]	2.0	0.9127
AT3G61320			Bestrophin-like protein (.1)		Lus10030389 [exp]	3.0	0.9086
AT5G49740		ATFRO7, FRO7	ferric reduction oxidase 7 (.1...		Lus10012161 [exp]	3.5	0.9108
AT3G11600			unknown protein		Lus10034181 [exp]	5.8	0.8710
AT2G21970		SEP2	stress enhanced protein 2 (.1)		Lus10035846 [exp]	6.3	0.9079
AT3G12685			Acid phosphatase/vanadium-depe...		Lus10001756 [exp]	7.5	0.8761
AT3G02380	CO	ATCOL2, COL2	CONSTANS-like 2 (.1)		Lus10005106 [exp]	8.5	0.8957
AT4G14805			Bifunctional inhibitor/lipid-t...		Lus10021910 [exp]	9.5	0.8090
AT5G19855		AtRbcX2	homologue of cyanobacterial Rb...		Lus10030141 [exp]	9.7	0.9051
					Lus10038478 [exp]	10.5	0.8599

Compare expression of checked genes

Lus10038566 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.