Lus10038613 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10038613 pacid=23143131 polypeptide=Lus10038613 locus=Lus10038613.g ID=Lus10038613.BGIv1.0 annot-version=v1.0
ATGAGTATAGGAGCAATAGTTGTGGCATTGTGGCTTGTTCGCAGTTGCCACCGGACTGAATACATGGTTGAGGCCTGGCTTCTGGTATTTCAGCTGTTAG
GCATAACAAAAGGGTTCCCTGTATCTCAAGCTACTATGGAAGAGTTTTTTACCGGGATGGAAGCAATGGAACCGAAAGCAATCATCCTGAATCAACTTTC
ATATGAATCCGCCAGAAAGGCAGCAACCACGGGTGCAAAATTCAAAGCAGCAATCCAGATGAATATTAAGTTAGCACCATCAGAGTTGTTCATGCCATAT
TCTGTAGTTAGGTACAACATCATGTTCATCGGCAGCCCATAA
AA sequence
>Lus10038613 pacid=23143131 polypeptide=Lus10038613 locus=Lus10038613.g ID=Lus10038613.BGIv1.0 annot-version=v1.0
MSIGAIVVALWLVRSCHRTEYMVEAWLLVFQLLGITKGFPVSQATMEEFFTGMEAMEPKAIILNQLSYESARKAATTGAKFKAAIQMNIKLAPSELFMPY
SVVRYNIMFIGSP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10038613 0 1
AT5G65550 UDP-Glycosyltransferase superf... Lus10043445 2.4 0.8786
AT4G19380 Long-chain fatty alcohol dehyd... Lus10037257 3.7 0.8625
AT5G46090 Protein of unknown function (D... Lus10013933 4.4 0.8995
AT1G03220 Eukaryotic aspartyl protease f... Lus10041225 9.4 0.8071
AT2G38080 ATLMCO4, IRX12,... LACCASE 4, IRREGULAR XYLEM 12,... Lus10040226 9.6 0.8688
AT2G40190 LEW3 LEAF WILTING 3, UDP-Glycosyltr... Lus10021233 9.9 0.8714
Lus10026392 13.2 0.7881
AT5G18310 unknown protein Lus10042520 13.5 0.8248
AT1G26690 emp24/gp25L/p24 family/GOLD fa... Lus10026625 13.6 0.8399
Lus10034979 16.7 0.8679

Lus10038613 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.