Lus10038614 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G52190 96 / 3e-23 Major facilitator superfamily protein (.1)
AT3G16180 92 / 6e-22 Major facilitator superfamily protein (.1)
AT1G72140 70 / 4e-14 Major facilitator superfamily protein (.1)
AT1G22540 69 / 7e-14 Major facilitator superfamily protein (.1)
AT1G22550 67 / 2e-13 Major facilitator superfamily protein (.1)
AT1G72120 66 / 6e-13 Major facilitator superfamily protein (.1)
AT1G69870 65 / 2e-12 NRT1.7 nitrate transporter 1.7 (.1)
AT3G54450 65 / 2e-12 Major facilitator superfamily protein (.1)
AT1G68570 64 / 5e-12 Major facilitator superfamily protein (.1)
AT1G22570 62 / 1e-11 Major facilitator superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025802 106 / 8e-27 AT1G52190 764 / 0.0 Major facilitator superfamily protein (.1)
Lus10035860 103 / 6e-26 AT1G52190 787 / 0.0 Major facilitator superfamily protein (.1)
Lus10038615 84 / 1e-19 AT1G27080 146 / 8e-40 nitrate transporter 1.6 (.1)
Lus10023663 85 / 2e-19 AT3G16180 559 / 0.0 Major facilitator superfamily protein (.1)
Lus10009505 74 / 2e-16 AT1G52190 208 / 8e-64 Major facilitator superfamily protein (.1)
Lus10016932 67 / 4e-13 AT1G22540 673 / 0.0 Major facilitator superfamily protein (.1)
Lus10034936 66 / 4e-13 AT3G16180 175 / 2e-51 Major facilitator superfamily protein (.1)
Lus10005417 65 / 2e-12 AT1G69850 446 / 1e-150 nitrate transporter 1:2 (.1)
Lus10040099 64 / 5e-12 AT2G02040 883 / 0.0 NITRATE TRANSPORTER 1, ARABIDOPSIS THALIANA PEPTIDE TRANSPORTER 2, peptide transporter 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G041600 108 / 7e-28 AT1G52190 590 / 0.0 Major facilitator superfamily protein (.1)
Potri.018G041500 108 / 1e-27 AT1G52190 561 / 0.0 Major facilitator superfamily protein (.1)
Potri.018G040500 107 / 2e-27 AT1G52190 561 / 0.0 Major facilitator superfamily protein (.1)
Potri.018G041400 107 / 2e-27 AT1G52190 562 / 0.0 Major facilitator superfamily protein (.1)
Potri.001G185700 102 / 2e-25 AT1G52190 785 / 0.0 Major facilitator superfamily protein (.1)
Potri.018G041800 102 / 3e-25 AT1G52190 551 / 0.0 Major facilitator superfamily protein (.1)
Potri.018G041700 94 / 1e-22 AT1G52190 562 / 0.0 Major facilitator superfamily protein (.1)
Potri.018G040400 89 / 1e-20 AT3G16180 559 / 0.0 Major facilitator superfamily protein (.1)
Potri.012G087500 84 / 7e-19 AT1G52190 542 / 0.0 Major facilitator superfamily protein (.1)
Potri.013G106600 72 / 4e-15 AT1G22540 666 / 0.0 Major facilitator superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10038614 pacid=23143059 polypeptide=Lus10038614 locus=Lus10038614.g ID=Lus10038614.BGIv1.0 annot-version=v1.0
ATGATACTTTCTGCTCTCTCTTTCTTCTCGGCTTCTCCATTTTATGCGAAGCAAGATGCCAAAGCAAGCTTGATCACTGCGCTTTCTCGAGTTCCTATAG
CTGCATTTAGAAACAGAGGAATCAAATTTCGTTCTAAATCGATTAAACAAGTCTATCATCATTCAGAGTCTGATAAAATGCATTTGGAGCCAAGTGACAA
CTTGAGGATTCCAAATTCCAGCAGCCTCATTCACCCTATTCATTACGATAACCCTGTTGATCTGGGTACCCCTCTATGTGTCATCATTCCTGTAGCTTCC
AAACTCAAAGGGAAACCTGCTAGATTTCCGGTGAAGCAAAGGTTGGGGCTTGGAATCCTTGTCAGTTCAGTATCAATGGCAGCACTAGGCACGGTCGAGA
GGATTCGACGCGAAAGGGCTATCAGTGAGGGGCTGTTAGATAATCCTACTGCTATTGTAGATATGTCTGCCATGTGGTTCTTGATGTACTACATCCCATT
TGGAGTAGCAGAGGCGTTTAATTACGTAGCGCAGAGTGAGTTTTATTACAGTTAG
AA sequence
>Lus10038614 pacid=23143059 polypeptide=Lus10038614 locus=Lus10038614.g ID=Lus10038614.BGIv1.0 annot-version=v1.0
MILSALSFFSASPFYAKQDAKASLITALSRVPIAAFRNRGIKFRSKSIKQVYHHSESDKMHLEPSDNLRIPNSSSLIHPIHYDNPVDLGTPLCVIIPVAS
KLKGKPARFPVKQRLGLGILVSSVSMAALGTVERIRRERAISEGLLDNPTAIVDMSAMWFLMYYIPFGVAEAFNYVAQSEFYYS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G52190 Major facilitator superfamily ... Lus10038614 0 1
AT2G46770 NAC NST1, ANAC043, ... NAC SECONDARY WALL THICKENING... Lus10002687 2.0 0.9628
AT2G46760 D-arabinono-1,4-lactone oxidas... Lus10010106 6.0 0.9206
AT1G13635 DNA glycosylase superfamily pr... Lus10019199 6.8 0.9520
AT4G14760 kinase interacting (KIP1-like)... Lus10021908 8.8 0.9480
AT1G27080 NRT1.6 nitrate transporter 1.6 (.1) Lus10038615 11.0 0.8902
AT1G71320 F-box family protein (.1) Lus10038210 11.0 0.9425
AT5G20630 ATGER3, GLP3A, ... GERMIN-LIKE PROTEIN 3, ARABIDO... Lus10037664 12.2 0.9299
AT5G46340 RWA1 REDUCED WALL ACETYLATION 1, O-... Lus10015265 14.6 0.9444
AT1G03010 Phototropic-responsive NPH3 fa... Lus10029443 15.4 0.9212
AT2G46760 D-arabinono-1,4-lactone oxidas... Lus10010107 15.7 0.9203

Lus10038614 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.