Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G44070 108 / 2e-29 ATPCS1, ARA8, CAD1 CADMIUM SENSITIVE 1, ARABIDOPSIS THALIANA PHYTOCHELATIN SYNTHASE 1, phytochelatin synthase 1 (PCS1) (.1) AT1G03980 96 / 5e-25 ATPCS2 phytochelatin synthase 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003622 [exp] 115 / 8e-32 AT5G44070 635 / 0.0 CADMIUM SENSITIVE 1, ARABIDOPSIS THALIANA PHYTOCHELATIN SYNTHASE 1, phytochelatin synthase 1 (PCS1) (.1) Lus10024921 [exp] 114 / 4e-31 AT5G44070 627 / 0.0 CADMIUM SENSITIVE 1, ARABIDOPSIS THALIANA PHYTOCHELATIN SYNTHASE 1, phytochelatin synthase 1 (PCS1) (.1) Lus10008241 [exp] 107 / 7e-29 AT1G03980 514 / 0.0 phytochelatin synthase 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G195800 [exp] 111 / 2e-30 AT5G44070 644 / 0.0 CADMIUM SENSITIVE 1, ARABIDOPSIS THALIANA PHYTOCHELATIN SYNTHASE 1, phytochelatin synthase 1 (PCS1) (.1) Potri.014G195900 [exp] 108 / 3e-29 AT5G44070 543 / 0.0 CADMIUM SENSITIVE 1, ARABIDOPSIS THALIANA PHYTOCHELATIN SYNTHASE 1, phytochelatin synthase 1 (PCS1) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0125 [flax] [poplar] Peptidase_CA PF05023 [flax] [poplar] Phytochelatin Phytochelatin synthase
Representative CDS sequence Show only first row Show all	>Lus10038621 pacid=23142988 polypeptide=Lus10038621 locus=Lus10038621.g ID=Lus10038621.BGIv1.0 annot-version=v1.0 ATGGCGATGGCTGGCTTTTACCGACAGGCACTCCCTTTCCCGCCTGCCATCGATTTCGCTTCCTCCGAAGGAAAGTTTGCAGCAAATTTTCCTGGAAAAG GTTCAGAATGGAACCATGAAGAGTTTCTTTTTAAGTTGATATCCTACTTCCAGACGCAGTCTGAGCCTGCCTATTGCGGCCTCGCGAGCCTCTCTATGGT TTTCAATGCACTTGCTATTGACCCTGGCAGGAAATGGAAAGGTAACGGCATTAGGTGGTAG
AA sequence Show only first row Show all	>Lus10038621 pacid=23142988 polypeptide=Lus10038621 locus=Lus10038621.g ID=Lus10038621.BGIv1.0 annot-version=v1.0 MAMAGFYRQALPFPPAIDFASSEGKFAANFPGKGSEWNHEEFLFKLISYFQTQSEPAYCGLASLSMVFNALAIDPGRKWKGNGIRW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G44070		ATPCS1, ARA8, C...	CADMIUM SENSITIVE 1, ARABIDOPS...		Lus10038621 [exp]	0	1

Compare expression of checked genes

Lus10038621 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.