Lus10038634 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10038634 pacid=23143160 polypeptide=Lus10038634 locus=Lus10038634.g ID=Lus10038634.BGIv1.0 annot-version=v1.0
ATGGCTCCCTTTCCATTTCTCTCAATAGCCATCATCTTCTTCTTCCCTTGTTGTCTCACTTATTGTTCATCCACCGCCATCCCGACTTCTCCAGCATTCC
TCGGAAACTCACCGCCGCTGTCTTCTTACCAACAACTCTCCCCTGACATAGCTCCATTGTTGCCAACTCCAGGTGGCAAGCTGCCTTCTCCATCGGTCAC
CTCCATCCCCACCATTCCTTCAAATCCAAGCTTTGAGTATCCTCAAGAGCTGGCTGCTGCACCTGCTTTCCCACCCATGGGAATGGGATCTGATCCTCCA
TTAGCTTCCTCTGCATCCTATCACAGCTACTTGCCACTCTCTTTACTTTCCACTGCATTTCTCTCCATTCAATTACTTTCCTTGTTCATAAAGACAATTG
TCCAGTGGATTCGACTGACATTGTCAGAGCCATAA
AA sequence
>Lus10038634 pacid=23143160 polypeptide=Lus10038634 locus=Lus10038634.g ID=Lus10038634.BGIv1.0 annot-version=v1.0
MAPFPFLSIAIIFFFPCCLTYCSSTAIPTSPAFLGNSPPLSSYQQLSPDIAPLLPTPGGKLPSPSVTSIPTIPSNPSFEYPQELAAAPAFPPMGMGSDPP
LASSASYHSYLPLSLLSTAFLSIQLLSLFIKTIVQWIRLTLSEP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10038634 0 1
AT4G02320 Plant invertase/pectin methyle... Lus10008203 2.4 0.9487
AT4G12730 FLA2 FASCICLIN-like arabinogalactan... Lus10001178 2.6 0.9591
AT1G07420 SMO2-1, ATSMO1,... Arabidopsis thaliana sterol 4-... Lus10016492 2.8 0.9468
AT5G15350 AtENODL17 early nodulin-like protein 17 ... Lus10030690 7.3 0.9229
AT3G44220 Late embryogenesis abundant (L... Lus10043410 9.2 0.9515
Lus10025731 9.2 0.9250
AT4G22010 SKS4 SKU5 similar 4 (.1) Lus10015545 9.5 0.9403
AT3G56130 biotin/lipoyl attachment domai... Lus10009843 10.1 0.9407
AT3G54770 RNA-binding (RRM/RBD/RNP motif... Lus10041423 11.2 0.9361
AT1G30690 Sec14p-like phosphatidylinosit... Lus10038435 11.8 0.9254

Lus10038634 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.