Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25050 134 / 3e-41 ACP4 acyl carrier protein 4 (.1.2) AT3G05020 126 / 2e-38 ACP1 acyl carrier protein 1 (.1) AT5G27200 114 / 2e-33 ACP5 acyl carrier protein 5 (.1) AT1G54630 114 / 2e-33 ACP3 acyl carrier protein 3 (.1.2) AT1G54580 113 / 3e-33 ACP2 acyl carrier protein 2 (.1) AT1G65290 50 / 9e-09 MTACP2 mitochondrial acyl carrier protein 2 (.1) AT2G44620 45 / 1e-06 MTACP1, MTACP-1 mitochondrial acyl carrier protein 1 (.1) AT5G47630 40 / 0.0001 MTACP3 mitochondrial acyl carrier protein 3 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038635 [exp] 263 / 2e-92 AT4G25050 134 / 3e-41 acyl carrier protein 4 (.1.2) Lus10037910 [exp] 249 / 6e-87 AT4G25050 130 / 4e-40 acyl carrier protein 4 (.1.2) Lus10037908 [exp] 249 / 7e-87 AT4G25050 132 / 8e-41 acyl carrier protein 4 (.1.2) Lus10033836 [exp] 139 / 1e-43 AT4G25050 137 / 2e-42 acyl carrier protein 4 (.1.2) Lus10018986 [exp] 136 / 3e-42 AT4G25050 136 / 3e-42 acyl carrier protein 4 (.1.2) Lus10020221 [exp] 53 / 1e-09 AT1G65290 183 / 4e-61 mitochondrial acyl carrier protein 2 (.1) Lus10026849 [exp] 54 / 2e-09 AT1G08450 590 / 0.0 PRIORITY IN SWEET LIFE 1, EMS-MUTAGENIZED BRI1 SUPPRESSOR 2, A. thaliana calreticulin 3, calreticulin 3 (.1.2.3) Lus10019500 [exp] 48 / 8e-08 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1) Lus10043348 [exp] 48 / 8e-08 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G044800 [exp] 142 / 1e-44 AT5G27200 146 / 5e-46 acyl carrier protein 5 (.1) Potri.013G031300 [exp] 139 / 2e-43 AT3G05020 142 / 1e-44 acyl carrier protein 1 (.1) Potri.012G105300 [exp] 130 / 5e-40 AT4G25050 107 / 8e-31 acyl carrier protein 4 (.1.2) Potri.015G104500 [exp] 128 / 5e-39 AT4G25050 122 / 2e-36 acyl carrier protein 4 (.1.2) Potri.006G217800 [exp] 87 / 1e-22 AT1G54630 94 / 2e-25 acyl carrier protein 3 (.1.2) Potri.013G084500 [exp] 57 / 2e-11 AT1G65290 188 / 5e-63 mitochondrial acyl carrier protein 2 (.1) Potri.019G055300 [exp] 55 / 3e-10 AT1G65290 196 / 6e-66 mitochondrial acyl carrier protein 2 (.1) Potri.006G005700 [exp] 53 / 8e-10 AT5G47630 107 / 5e-31 mitochondrial acyl carrier protein 3 (.1.2) Potri.016G006300 [exp] 53 / 1e-09 AT5G47630 111 / 1e-32 mitochondrial acyl carrier protein 3 (.1.2) Potri.014G044000 [exp] 48 / 7e-08 AT2G44620 163 / 2e-53 mitochondrial acyl carrier protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0314 [flax] [poplar] PP-binding PF00550 [flax] [poplar] PP-binding Phosphopantetheine attachment site
Representative CDS sequence Show only first row Show all	>Lus10038636 pacid=23143115 polypeptide=Lus10038636 locus=Lus10038636.g ID=Lus10038636.BGIv1.0 annot-version=v1.0 ATGGCTTCCCTCACAAATGCCGCTGTCTCCATGCTGTCCATCTCCACCTCTTCCCTCAGGCAGAGCCACCAGAGGTTCTCTGGGCTCAATTCGGTGTCAT ATCCCGCTAGTGGAAGTGTGATTCCTTCTCGCAGGCTTCAAGTGTGCTGCGCGGCCAAGCCAGAGACTGTAGAGAAAGTGGTTGCCATAGTGAAGAAGCA GCTGGCACTGTCAGACGATACAGCCATCACTGGAGACTCCAAGTTTTCTGCACTCGGAGCTGACTCCCTTGATACTGTTGAGATTGTGATGGGGCTTGAG GAAGAGTTCAACATCACCGTGGAAGAAGAGAGCGCACAGAGCATTACCACCGTTCAAGAGGCTGCAGATATGATTGAGAAGCTTGCTGGGAAGTGA
AA sequence Show only first row Show all	>Lus10038636 pacid=23143115 polypeptide=Lus10038636 locus=Lus10038636.g ID=Lus10038636.BGIv1.0 annot-version=v1.0 MASLTNAAVSMLSISTSSLRQSHQRFSGLNSVSYPASGSVIPSRRLQVCCAAKPETVEKVVAIVKKQLALSDDTAITGDSKFSALGADSLDTVEIVMGLE EEFNITVEEESAQSITTVQEAADMIEKLAGK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G25050		ACP4	acyl carrier protein 4 (.1.2)		Lus10038636 [exp]	0	1
AT4G25050		ACP4	acyl carrier protein 4 (.1.2)		Lus10037910 [exp]	1.0	0.8308
AT3G22630		PRCGB, PBD1	20S proteasome beta subunit D1...		Lus10039351 [exp]	2.4	0.7972
AT3G27090			DCD (Development and Cell Deat...		Lus10041557 [exp]	2.8	0.7876
AT5G41050			Pollen Ole e 1 allergen and ex...		Lus10012553 [exp]	7.1	0.7952
AT1G62640		KAS III, KASIII	3-ketoacyl-acyl carrier protei...		Lus10004342 [exp]	8.0	0.7604
AT4G02610			Aldolase-type TIM barrel famil...		Lus10024849 [exp]	8.8	0.7635
AT4G02610			Aldolase-type TIM barrel famil...		Lus10018760 [exp]	9.2	0.7223
AT5G58300			Leucine-rich repeat protein ki...		Lus10003891 [exp]	9.4	0.7064
AT1G77580			Plant protein of unknown funct...		Lus10018164 [exp]	9.5	0.7589
AT2G32580			Protein of unknown function (D...		Lus10029975 [exp]	15.1	0.7496

Compare expression of checked genes

Lus10038636 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.