Lus10038642 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027118 188 / 2e-62 ND /
Lus10017801 118 / 3e-34 ND /
Lus10038483 112 / 3e-33 ND /
Lus10007416 100 / 5e-26 ND /
Lus10026444 93 / 7e-23 ND /
Lus10029488 92 / 1e-22 ND /
Lus10039353 83 / 3e-19 ND /
Lus10006886 81 / 8e-19 ND /
Lus10042979 81 / 2e-18 AT5G08020 54 / 5e-07 ARABIDOPSIS THALIANA RPA70-KDA SUBUNIT B, RPA70-kDa subunit B (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10038642 pacid=23143053 polypeptide=Lus10038642 locus=Lus10038642.g ID=Lus10038642.BGIv1.0 annot-version=v1.0
ATGTTCTTGCGTGATATTGTGGTGGCCGACCCTCCGGCCGAACTTCAGCTCCGCCTCCAACACATTTGGCGGCTCTGCAACCCGCCGGAGCCGGAACAAC
ATTGTGCCTTGGGTACTCTTTGGACAGACGATGATGAACACCGCATCGAAGAATACACCGAGCCTGATGATGTCGAGGAGGTCACTAGGCTCATTGCCGA
AGGCTCTATTTACAAAATCCACAATCCCTATCTTATACGAGCTCGCTCCGCAATGCGCTCGTGTCCAGGAGATTTCTCAATTTCCATTCGCTCTGAAAAC
CTGCTCCACAAAGTTGAGGAAGACCCTGAACGACCGTTTTTCCCCGCATTTGCCTTCAGCATAGTTACCACTAAAATGCTGCGTGCCGCACCTCCCGGTC
AAACTGCTTCGTCAGGTCGTCCCTAA
AA sequence
>Lus10038642 pacid=23143053 polypeptide=Lus10038642 locus=Lus10038642.g ID=Lus10038642.BGIv1.0 annot-version=v1.0
MFLRDIVVADPPAELQLRLQHIWRLCNPPEPEQHCALGTLWTDDDEHRIEEYTEPDDVEEVTRLIAEGSIYKIHNPYLIRARSAMRSCPGDFSISIRSEN
LLHKVEEDPERPFFPAFAFSIVTTKMLRAAPPGQTASSGRP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10038642 0 1
Lus10043100 1.7 0.9848
AT5G66740 Protein of unknown function (D... Lus10026031 2.6 0.9613
AT2G44450 BGLU15 beta glucosidase 15 (.1) Lus10026057 3.5 0.9773
Lus10032696 4.5 0.9707
AT1G65480 FT FLOWERING LOCUS T, PEBP (phosp... Lus10004452 5.7 0.9585
AT5G41850 alpha/beta-Hydrolases superfam... Lus10023100 7.7 0.9533
AT4G18060 SH3 domain-containing protein ... Lus10025372 9.8 0.8498
AT5G60440 MADS AGL62 AGAMOUS-like 62 (.1) Lus10003481 10.1 0.9788
AT5G01370 ACI1 ALC-interacting protein 1 (.1) Lus10001252 13.0 0.8754
AT2G35190 NSPN11, ATNPSN1... novel plant snare 11 (.1) Lus10003004 16.9 0.9642

Lus10038642 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.