Lus10038645 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G01610 202 / 8e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G14890 196 / 2e-63 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G23205 156 / 6e-48 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G70720 154 / 5e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62760 128 / 1e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62350 122 / 8e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25260 119 / 2e-33 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62360 117 / 8e-33 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G47380 113 / 4e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62770 113 / 6e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031138 121 / 3e-34 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038914 119 / 2e-33 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10027198 118 / 3e-33 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031711 117 / 9e-33 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038915 117 / 2e-32 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031133 114 / 2e-31 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10028910 114 / 4e-31 AT1G62760 169 / 1e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10004327 112 / 2e-30 AT1G62760 164 / 8e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10027199 110 / 8e-30 AT5G62360 169 / 3e-53 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G132600 236 / 2e-79 AT1G14890 216 / 1e-71 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.010G109300 230 / 8e-77 AT1G14890 218 / 5e-72 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128300 131 / 3e-38 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128100 125 / 8e-36 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128700 124 / 3e-35 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128200 121 / 2e-34 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.012G127500 121 / 3e-34 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113700 118 / 4e-33 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1)
Potri.012G127400 117 / 1e-32 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113600 115 / 7e-32 AT1G62760 171 / 1e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10038645 pacid=23143162 polypeptide=Lus10038645 locus=Lus10038645.g ID=Lus10038645.BGIv1.0 annot-version=v1.0
ATGACAACAACCACCACTTTCCTTCAACCTCCGCTTCTCCTCCTTCTTTTCCTCCTCCTTCTCCTAAACCCTCTTTCCTCGGCCGCCGCATCCGACGACG
ACAACAACAACAATAATAACCAATCCGCTAACTCCACCGCCGACTATATCCGCTCCAGCTGCAACGCCACGCTGTACCCGGACGTCTGCTACACTTCCCT
CTCCCGCTATGCCAGCGCCGTCCAGCAGAGCCCCTCCCGTCTCGCCGTCGTGGCCGTCGGCGTCAGCCTTTCCAGGGCCAGCCGCACCGCCAGGTTTGTC
GCCGACGCCTCGTCCCAGGCCGACTACGGCTCCGACCGCCGCACTGCCTCCGCCCTCCACGACTGCCTCTCCAGCTTCGGCGACGCCATCGACGAGATCC
GAAGCTCCCTGAAGCAGATGCGAGAGCTAGGGGAATCGGCCGGATCTTCTTCTTCTTCGGCGGAGGAGTTCCGGTTCCAGATGAGCAACGTGCAGACATG
GATCAGCGCGGCGCTTACGGACGAGGAGACGTGTACGGACGGGTTCGAGGAGATCGGTGAGGGGGGAGTGAAGGAGGCGATTTGCAAGCGTGCGGAGGTG
GCCAAGAAGTTCACGAGTAATGCGCTTGCCTTGGTTAACAGTTACGCTGCCGCCGGAATCCCCTAG
AA sequence
>Lus10038645 pacid=23143162 polypeptide=Lus10038645 locus=Lus10038645.g ID=Lus10038645.BGIv1.0 annot-version=v1.0
MTTTTTFLQPPLLLLLFLLLLLNPLSSAAASDDDNNNNNNQSANSTADYIRSSCNATLYPDVCYTSLSRYASAVQQSPSRLAVVAVGVSLSRASRTARFV
ADASSQADYGSDRRTASALHDCLSSFGDAIDEIRSSLKQMRELGESAGSSSSSAEEFRFQMSNVQTWISAALTDEETCTDGFEEIGEGGVKEAICKRAEV
AKKFTSNALALVNSYAAAGIP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G01610 Plant invertase/pectin methyle... Lus10038645 0 1
AT1G46480 HD WOX4 WUSCHEL related homeobox 4 (.1... Lus10024808 2.0 0.9456
Lus10040587 3.0 0.9447
AT3G49750 AtRLP44 receptor like protein 44 (.1) Lus10011561 3.6 0.9456
AT2G36570 Leucine-rich repeat protein ki... Lus10021131 6.6 0.8942
AT3G45230 hydroxyproline-rich glycoprote... Lus10041306 7.3 0.9350
AT5G25190 AP2_ERF ESE3 ethylene and salt inducible 3,... Lus10041023 8.1 0.8839
AT5G60640 ATPDI2, ATPDIL1... ARABIDOPSIS THALIANA PROTEIN D... Lus10041307 9.2 0.9209
AT1G46480 HD WOX4 WUSCHEL related homeobox 4 (.1... Lus10018726 10.2 0.9213
Lus10016903 10.2 0.9284
AT2G04480 unknown protein Lus10032584 11.0 0.9253

Lus10038645 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.