Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02420 47 / 2e-07 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037925 [exp] 220 / 1e-75 AT5G02420 47 / 2e-07 unknown protein Lus10017454 [exp] 64 / 8e-14 ND 38 / 3e-04 Lus10040827 [exp] 49 / 1e-07 AT3G20898 44 / 8e-06 unknown protein Lus10016559 [exp] 46 / 8e-07 AT2G37610 39 / 2e-04 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G029600 [exp] 99 / 8e-28 AT5G02420 48 / 5e-08 unknown protein Potri.010G231600 [exp] 94 / 1e-25 AT5G02420 44 / 1e-06 unknown protein Potri.010G231700 [exp] 72 / 2e-17 AT5G04470 / SIAMESE, cyclin-dependent protein kinase inhibitors (.1) Potri.001G212300 [exp] 57 / 4e-11 AT5G02420 43 / 8e-06 unknown protein Potri.009G003400 [exp] 55 / 1e-10 AT5G02420 45 / 7e-07 unknown protein Potri.001G239000 [exp] 47 / 4e-07 AT5G02420 59 / 1e-11 unknown protein Potri.009G030200 [exp] 45 / 1e-06 AT5G02420 49 / 5e-08 unknown protein Potri.009G053000 [exp] 43 / 6e-06 AT3G20898 76 / 9e-19 unknown protein Potri.006G053600 [exp] 40 / 4e-05 AT3G20898 67 / 1e-15 unknown protein Potri.001G257700 [exp] 40 / 0.0001 AT3G20898 78 / 1e-19 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038653 pacid=23143091 polypeptide=Lus10038653 locus=Lus10038653.g ID=Lus10038653.BGIv1.0 annot-version=v1.0 ATGTCCGCACATCTCGATTCCCTCCCCGATTTGCCCAAAATCCGACTCATAACCCAGCATCCTACGCAAACGGCGGAGCCTTCCACCAGCGGATCCAGTG TCGGGGATGGACCCGCGGACGGAAATTCAGATAAGAAGCAGGAGAATTATGGAGATGATGAGTGCCGGACCCCAAAATCGGCCGAGTTCAAGATCCCAGC GATCCTGAAATGCCCGCCGGCCCCTAGGAAACCGAAATCCAGAGCGTCAGCCTCTTGTAAGCGGAAGCTGATTTCGGAATTGGACTTGTTCGACGTGGTG AACCGCGAGGAAGTTGAATCCTTCTTCCGAGCCGCCGCCTCCAAACGGAGGTGCCCCGATCTGGTTCCACCTCTTTCTAAATATTTGAATTAA
AA sequence Show only first row Show all	>Lus10038653 pacid=23143091 polypeptide=Lus10038653 locus=Lus10038653.g ID=Lus10038653.BGIv1.0 annot-version=v1.0 MSAHLDSLPDLPKIRLITQHPTQTAEPSTSGSSVGDGPADGNSDKKQENYGDDECRTPKSAEFKIPAILKCPPAPRKPKSRASASCKRKLISELDLFDVV NREEVESFFRAAASKRRCPDLVPPLSKYLN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G02420			unknown protein		Lus10038653 [exp]	0	1
AT5G42000			ORMDL family protein (.1.2)		Lus10003209 [exp]	5.5	0.7448
AT5G24010			Protein kinase superfamily pro...		Lus10039274 [exp]	5.5	0.7632
AT5G19080			RING/U-box superfamily protein...		Lus10034030 [exp]	5.7	0.7586
AT3G27010	TCP	ATTCP20, PCF1, ...	ARABIDOPSIS THALIANA TEOSINTE ...		Lus10015760 [exp]	11.0	0.7532
AT4G11680			Zinc finger, C3HC4 type (RING ...		Lus10006313 [exp]	11.1	0.7631
AT1G68070			Zinc finger, C3HC4 type (RING ...		Lus10034587 [exp]	17.2	0.7204
AT3G19950			RING/U-box superfamily protein...		Lus10010179 [exp]	19.7	0.7128
AT2G31820			Ankyrin repeat family protein ...		Lus10008329 [exp]	20.4	0.6798
AT2G23340	AP2_ERF	DEAR3	DREB and EAR motif protein 3 (...		Lus10010043 [exp]	20.5	0.7395
AT2G40830		RHC1A	RING-H2 finger C1A (.1.2.3)		Lus10030755 [exp]	21.5	0.6965

Compare expression of checked genes

Lus10038653 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.