Lus10038657 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G06920 328 / 6e-107 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G22470 125 / 9e-33 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G11690 115 / 2e-29 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G12620 115 / 3e-29 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G02150 112 / 5e-28 EMB2794 EMBRYO DEFECTIVE 2794, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G12300 111 / 6e-28 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G06710 110 / 1e-27 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G39710 110 / 2e-27 EMB2745 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G16710 104 / 2e-25 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G09900 104 / 2e-25 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043417 394 / 8e-132 AT3G06920 1358 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10011464 119 / 1e-30 AT3G16010 888 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10040633 113 / 2e-28 AT3G61520 586 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10023863 110 / 2e-27 AT5G12100 728 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Lus10014242 107 / 1e-26 AT1G62930 256 / 5e-78 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10003424 105 / 8e-26 AT4G31850 1373 / 0.0 proton gradient regulation 3 (.1)
Lus10007468 105 / 9e-26 AT5G01110 808 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10003433 105 / 1e-25 AT1G12700 396 / 2e-129 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10025533 105 / 2e-25 AT1G06710 980 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G014100 345 / 2e-113 AT3G06920 1404 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G180000 121 / 3e-31 AT3G16010 950 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.016G025600 114 / 1e-28 AT3G22470 426 / 3e-141 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.014G117600 112 / 2e-28 AT1G12700 330 / 1e-105 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.007G123600 112 / 3e-28 AT1G06710 1248 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G130600 111 / 4e-28 AT1G12700 330 / 3e-105 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.004G013300 110 / 1e-27 AT3G53700 1092 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G046000 110 / 2e-27 AT1G63130 405 / 9e-133 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G035700 109 / 3e-27 AT1G05670 922 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Potri.014G090400 109 / 4e-27 AT5G28460 637 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10038657 pacid=23143036 polypeptide=Lus10038657 locus=Lus10038657.g ID=Lus10038657.BGIv1.0 annot-version=v1.0
ATGTATACTCATCCCTCATTTGCAACTTTTGAGCATGACAGGAAAGAGGAGTGCCACAAGATATACAAAGAAATGATCCAAAGAGGCTGTTCACCTGATC
TTGTCCTTCTTAACACCTACATGGATTGTGCTTTCAAAGCCGGTGAAGGTGAAAAGGGGAGGAGTTTATTTGAGGAGATAAGGGCTTGTGGACTTGTTCC
AGATATTAGAAGCTATTCTATCCTCATTCATAGCCTGATCAAAGCTGATTTTGCATGTGAAACCTATGAACTGTTCTACTCTATGAAAGACCAAGGCTGT
TGTGTATTGGACACTCGTGCCTACAACACTATTATTGATGGGTTTTGCAAGTCAGGGAAAGTAAATAAAGCTTATCAGCCTCTAGATGAGTTGAAGACAA
AAGGCCACCATCGAACAGTAGTCACCTATGGTTCAGTCATTGACAGCCTTTGCAAAATTGACAGACTTGATGTAGCATACATGCTGTTTGAAGAAACAAG
AGATGGTGTAGAAAGGCTCGATGCACTCGTGAAAGCAGAAAAAATTGACGAGGCTGTGGTTTGCTTTCGGCACATGAAGGACCTCGGGTGCATTCCGAAT
CAAATAACATACAGTATCCTCATAAACGGTCTCGGTAGACTCAAGAAATTCACAAAGGCCTTTGTATTCTGGCAAAAGATGCAGAAGCAAGGGTTGAAGC
CAAATACTATCACCTCTTGCCAAGGCAGGTAA
AA sequence
>Lus10038657 pacid=23143036 polypeptide=Lus10038657 locus=Lus10038657.g ID=Lus10038657.BGIv1.0 annot-version=v1.0
MYTHPSFATFEHDRKEECHKIYKEMIQRGCSPDLVLLNTYMDCAFKAGEGEKGRSLFEEIRACGLVPDIRSYSILIHSLIKADFACETYELFYSMKDQGC
CVLDTRAYNTIIDGFCKSGKVNKAYQPLDELKTKGHHRTVVTYGSVIDSLCKIDRLDVAYMLFEETRDGVERLDALVKAEKIDEAVVCFRHMKDLGCIPN
QITYSILINGLGRLKKFTKAFVFWQKMQKQGLKPNTITSCQGR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G06920 Tetratricopeptide repeat (TPR)... Lus10038657 0 1
AT4G33920 Protein phosphatase 2C family ... Lus10000700 2.8 1.0000
AT5G22460 alpha/beta-Hydrolases superfam... Lus10004882 4.0 1.0000
AT1G66950 ABCG39, PDR11, ... ATP-binding cassette G39, plei... Lus10006277 4.9 1.0000
AT2G29670 Tetratricopeptide repeat (TPR)... Lus10025981 5.7 1.0000
AT5G51740 Peptidase family M48 family pr... Lus10032437 6.3 1.0000
AT1G69940 ATPPME1 Pectin lyase-like superfamily ... Lus10016711 6.9 1.0000
AT1G35670 CPK11, ATCDPK2,... calcium-dependent protein kina... Lus10017911 7.0 1.0000
Lus10026426 7.1 0.9602
AT2G37360 ABCG2 ATP-binding cassette G2, ABC-2... Lus10039859 7.9 1.0000
AT4G20060 EMB1895 EMBRYO DEFECTIVE 1895, ARM rep... Lus10038371 8.0 1.0000

Lus10038657 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.