Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G28605 116 / 1e-33 Photosystem II reaction center PsbP family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039615 [exp] 209 / 2e-69 AT2G28605 226 / 7e-74 Photosystem II reaction center PsbP family protein (.1) Lus10029532 [exp] 196 / 2e-64 AT2G28605 248 / 4e-83 Photosystem II reaction center PsbP family protein (.1) Lus10009159 [exp] 48 / 8e-08 AT2G28605 98 / 3e-26 Photosystem II reaction center PsbP family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G100800 [exp] 131 / 4e-39 AT2G28605 266 / 2e-90 Photosystem II reaction center PsbP family protein (.1) Potri.005G068500 [exp] 104 / 1e-28 AT2G28605 173 / 4e-54 Photosystem II reaction center PsbP family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0619 [flax] [poplar] Mog1p_PsbP PF01789 [flax] [poplar] PsbP PsbP
Representative CDS sequence Show only first row Show all	>Lus10038658 pacid=23143114 polypeptide=Lus10038658 locus=Lus10038658.g ID=Lus10038658.BGIv1.0 annot-version=v1.0 ATGTTTCCTTCTCCTGTAAGGAGAAAATTGAATCTCTCACTTGTTGGATTGACGGTCATTCTTAATGAGTATTGGTCATTAATCTCATCTACGACCACCA TTTTGGCTGAAGAAGATTTGAAACTTGAAAGATACACTGATTATCAAGAGGACTTCACTCTGCTCAGGCCTGCTTCCTATTCTAAAGTGGGTAAATCTGG AGCAATTTTGCTGTTTGAGGAGACGAAGAAAGCAAGCAACAATGTTGGGCTTGTGGTCATCCCAGTTCGTCTTAAGATCCTTGCTGAATTTGGGACTCCT CAATTTGTTGCAGACAAGCTTATACAAGCCGAAAAGCGCAAAGAGAGTACGAAAGAGGCATAG
AA sequence Show only first row Show all	>Lus10038658 pacid=23143114 polypeptide=Lus10038658 locus=Lus10038658.g ID=Lus10038658.BGIv1.0 annot-version=v1.0 MFPSPVRRKLNLSLVGLTVILNEYWSLISSTTTILAEEDLKLERYTDYQEDFTLLRPASYSKVGKSGAILLFEETKKASNNVGLVVIPVRLKILAEFGTP QFVADKLIQAEKRKESTKEA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G28605			Photosystem II reaction center...		Lus10038658 [exp]	0	1
AT1G64060		RBOHAP108, ATRB...	ARABIDOPSIS THALIANA RESPIRATO...		Lus10017850 [exp]	8.7	0.8534
AT2G25810		TIP4;1	tonoplast intrinsic protein 4;...		Lus10037895 [exp]	13.6	0.8537
AT3G55770	LIM	WLIM2b	WLIM2b, GATA type zinc finger ...		Lus10034123 [exp]	15.1	0.8452
AT2G17080			Arabidopsis protein of unknown...		Lus10025121 [exp]	16.4	0.8346
					Lus10025501 [exp]	22.9	0.8470
AT1G75540	CO	LHUS, AtBBX21, ...	long hypocotyl under shade, B-...		Lus10033184 [exp]	23.1	0.8255
AT3G12540			Protein of unknown function, D...		Lus10040290 [exp]	27.5	0.8003
AT3G49870		ATARLA1C	ADP-ribosylation factor-like A...		Lus10019259 [exp]	28.3	0.8378
AT1G06400		ARA2, AtRABA1a,...	ARABIDOPSIS THALIANA RAB GTPAS...		Lus10020746 [exp]	30.0	0.7895
AT1G52800			2-oxoglutarate (2OG) and Fe(II...		Lus10013132 [exp]	30.9	0.8213

Compare expression of checked genes

Lus10038658 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.