Lus10038662 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037930 189 / 4e-63 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10038662 pacid=23143008 polypeptide=Lus10038662 locus=Lus10038662.g ID=Lus10038662.BGIv1.0 annot-version=v1.0
ATGGGGAGCAAGATGAGAGGATTTGTTGTGTTGGTTGCAGTGGCTGCAACAACGTTGATGCTGTTTGCTGGGCAATGCCACTCAGCTCCTTCTATTGATG
CTAAGGGTGGTAAAGGCCACAAGATGGAACTCGATGCATGCAACCCACTCTGCTTCTTCCAATGTGCTGTCGACAAAGGCGACATGTTCTGCTATGGCAA
GTGCCTCATCGGGTGCATTGCACTCGTTAACGGGAAACTTGACCCCAGTAAACCCCGAGACATCTGCCTCGTCACCTGTGCTGTCCCTGGCTGTGCTAGC
CTCTGCACCAAAGAGCACCCTTTCCCCGTGAAAAAAGTACAAACTTGTCTGCAGACTTGCTCAGACAACTGTGACGACATCAAGCCTGATAATTAA
AA sequence
>Lus10038662 pacid=23143008 polypeptide=Lus10038662 locus=Lus10038662.g ID=Lus10038662.BGIv1.0 annot-version=v1.0
MGSKMRGFVVLVAVAATTLMLFAGQCHSAPSIDAKGGKGHKMELDACNPLCFFQCAVDKGDMFCYGKCLIGCIALVNGKLDPSKPRDICLVTCAVPGCAS
LCTKEHPFPVKKVQTCLQTCSDNCDDIKPDN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10038662 0 1
Lus10000456 9.9 0.7708
AT5G27730 Protein of unknown function (D... Lus10020653 37.7 0.8055
AT2G36950 Heavy metal transport/detoxifi... Lus10032245 39.0 0.8133
AT3G48340 CEP2 cysteine endopeptidase 2, Cyst... Lus10033631 47.5 0.8043
AT4G16800 ATP-dependent caseinolytic (Cl... Lus10000420 53.7 0.7920
AT4G17260 Lactate/malate dehydrogenase f... Lus10002982 85.4 0.7889
AT1G14820 Sec14p-like phosphatidylinosit... Lus10021817 171.3 0.7671
AT5G60860 AtRABA1f RAB GTPase homolog A1F (.1) Lus10015297 221.8 0.7534

Lus10038662 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.