Lus10038669 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G55620 335 / 3e-118 eIF6A, EMB1624 embryo defective 1624, eukaryotic initiation facor 6A, Translation initiation factor IF6 (.1)
AT2G39820 268 / 6e-92 eIF6B eukaryotic initiation factor 6B, Translation initiation factor IF6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037938 355 / 5e-126 AT3G55620 473 / 4e-172 embryo defective 1624, eukaryotic initiation facor 6A, Translation initiation factor IF6 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G229800 345 / 2e-122 AT3G55620 472 / 2e-171 embryo defective 1624, eukaryotic initiation facor 6A, Translation initiation factor IF6 (.1)
Potri.007G064800 327 / 4e-115 AT3G55620 454 / 2e-164 embryo defective 1624, eukaryotic initiation facor 6A, Translation initiation factor IF6 (.1)
Potri.005G098700 302 / 2e-106 AT3G55620 311 / 5e-109 embryo defective 1624, eukaryotic initiation facor 6A, Translation initiation factor IF6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0197 GME PF01912 eIF-6 eIF-6 family
Representative CDS sequence
>Lus10038669 pacid=23142997 polypeptide=Lus10038669 locus=Lus10038669.g ID=Lus10038669.BGIv1.0 annot-version=v1.0
ATGGCGACTAGAAACAAAAACGGGCTTCTTGTTCCACACACCACCACTGATCAGGAGCTTCAGCACTTGAGAAACAGTCTCCCTGATTCAGTCGTTGTCC
AGAGGATAGAGGAAAGATTGTCAGCACTCGGTAACTGTATCGCTTGTAATGACCATGTTGCTCTTGCACATATTGATCTCGACCGGGAAACTGAAGAGTT
GATTGCTGATGTCCTTGGAGTTGAAGTTTTCAGACAGACTATTGCTGGGAATGTTCTTGTTGGAACCTATTGTGCCTTCTCTAACAGAGGTGGCTTGGTC
CACCCGCACACTTCAATGGAAGACATGGATGAGCTTTCCACTCTTCTCCAAGTCCCTTTGGTTGCAGGGACTGTTAACCGTGGCTGTGATGTTATAGGAG
CAGGAATGACAGTAAATGACTGGACAGCATTCATTGGTTCGGACACTACAGCAACAGAGCTATCTGTTATTGAGAGTGTATTCAAGTTGAGGGAAGCTCA
ACCAAGTGCCATCATGGACGAGATGAGGAAGTCTCTGGTTGACACTTACGTCTGA
AA sequence
>Lus10038669 pacid=23142997 polypeptide=Lus10038669 locus=Lus10038669.g ID=Lus10038669.BGIv1.0 annot-version=v1.0
MATRNKNGLLVPHTTTDQELQHLRNSLPDSVVVQRIEERLSALGNCIACNDHVALAHIDLDRETEELIADVLGVEVFRQTIAGNVLVGTYCAFSNRGGLV
HPHTSMEDMDELSTLLQVPLVAGTVNRGCDVIGAGMTVNDWTAFIGSDTTATELSVIESVFKLREAQPSAIMDEMRKSLVDTYV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G55620 eIF6A, EMB1624 embryo defective 1624, eukaryo... Lus10038669 0 1
AT3G47840 Tetratricopeptide repeat (TPR)... Lus10019098 1.4 0.6793
AT1G75790 SKS18 SKU5 similar 18 (.1) Lus10038672 7.1 0.6755
AT2G25660 EMB2410 embryo defective 2410 (.1) Lus10012415 9.8 0.5913
AT2G42010 PLDBETA1 phospholipase D beta 1 (.1) Lus10026377 14.0 0.6346
AT5G09300 Thiamin diphosphate-binding fo... Lus10033480 15.2 0.6014
AT1G31360 MED34, ATRECQ2,... ARABIDOPSIS THALIANA RECQ 2, ... Lus10034749 25.8 0.6156
AT5G18070 DRT101 DNA-DAMAGE-REPAIR/TOLERATION 1... Lus10007548 26.1 0.6212
AT1G05160 ATKAO1, CYP88A3 ENT-KAURENOIC ACID OXYDASE 1, ... Lus10036670 37.8 0.5597
AT5G35910 Polynucleotidyl transferase, r... Lus10020293 44.0 0.5673
AT3G29390 RIK RS2-interacting KH protein (.1... Lus10032979 44.9 0.5789

Lus10038669 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.