Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G54920 103 / 3e-27 PMR6 powdery mildew resistant 6, Pectin lyase-like superfamily protein (.1) AT5G04310 100 / 9e-26 Pectin lyase-like superfamily protein (.1) AT3G53190 90 / 3e-22 Pectin lyase-like superfamily protein (.1) AT4G13710 81 / 3e-19 Pectin lyase-like superfamily protein (.1.2) AT3G24230 70 / 2e-15 Pectate lyase family protein (.1) AT3G27400 65 / 2e-13 Pectin lyase-like superfamily protein (.1) AT4G13210 61 / 6e-12 Pectin lyase-like superfamily protein (.1.2) AT5G15110 60 / 1e-11 Pectate lyase family protein (.1) AT1G14420 59 / 2e-11 AT59 Pectate lyase family protein (.1) AT1G11920 58 / 4e-11 Pectin lyase-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037945 [exp] 147 / 3e-42 AT3G54920 599 / 0.0 powdery mildew resistant 6, Pectin lyase-like superfamily protein (.1) Lus10023542 [exp] 106 / 3e-28 AT5G04310 579 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10040426 [exp] 103 / 4e-27 AT5G04310 380 / 8e-125 Pectin lyase-like superfamily protein (.1) Lus10023917 [exp] 88 / 1e-21 AT3G53190 696 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10014414 [exp] 88 / 2e-21 AT3G53190 703 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10042509 [exp] 71 / 5e-16 AT4G13710 367 / 3e-127 Pectin lyase-like superfamily protein (.1.2) Lus10038157 [exp] 71 / 2e-15 AT4G13710 685 / 0.0 Pectin lyase-like superfamily protein (.1.2) Lus10014887 [exp] 67 / 3e-14 AT5G63180 620 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10022310 [exp] 66 / 1e-13 AT5G63180 626 / 0.0 Pectin lyase-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G229000 [exp] 112 / 3e-30 AT5G04310 583 / 0.0 Pectin lyase-like superfamily protein (.1) Potri.008G032700 [exp] 108 / 5e-29 AT5G04310 556 / 0.0 Pectin lyase-like superfamily protein (.1) Potri.006G122000 [exp] 96 / 3e-24 AT3G53190 647 / 0.0 Pectin lyase-like superfamily protein (.1) Potri.001G339500 [exp] 69 / 4e-15 AT4G24780 617 / 0.0 Pectin lyase-like superfamily protein (.1.2) Potri.001G052300 [exp] 66 / 9e-14 AT4G13710 696 / 0.0 Pectin lyase-like superfamily protein (.1.2) Potri.003G175900 [exp] 66 / 1e-13 AT4G13710 681 / 0.0 Pectin lyase-like superfamily protein (.1.2) Potri.014G178100 [exp] 61 / 4e-12 AT3G07010 652 / 0.0 Pectin lyase-like superfamily protein (.1) Potri.011G093400 [exp] 58 / 5e-11 AT5G63180 509 / 0.0 Pectin lyase-like superfamily protein (.1) Potri.008G148800 [exp] 56 / 3e-10 AT5G15110 523 / 0.0 Pectate lyase family protein (.1) Potri.012G091500 [exp] 56 / 3e-10 AT4G24780 645 / 0.0 Pectin lyase-like superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10038679 pacid=23143081 polypeptide=Lus10038679 locus=Lus10038679.g ID=Lus10038679.BGIv1.0 annot-version=v1.0 ATGCAGGTAACGAAGCGCGTGGACACGGAGGACAATGAGTGGACAGACTGGAATTGGAGAACGGACGGGGACATAATGGTAAATGGAGCATTCTTTGTAC CGTCGGGAGCAGGGGGCGTGAGCGTTCAGTATCAAAAGGCTTCCAGCGTGGACCCCAAGTCAGCTGTGCTTGTTGACCAGCTCACCTTGAACGCCGGCGT CCTCGGTGGTCCCAGGGTAGGGTGGCCTGATTGCCCTACCTCGTCCAAGCTGGACCACCCAACCCACCAAATACTATCCTCATTATTCCCTTGCAGTGGG CAGAGAGCTCTGCTTTGA
AA sequence Show only first row Show all	>Lus10038679 pacid=23143081 polypeptide=Lus10038679 locus=Lus10038679.g ID=Lus10038679.BGIv1.0 annot-version=v1.0 MQVTKRVDTEDNEWTDWNWRTDGDIMVNGAFFVPSGAGGVSVQYQKASSVDPKSAVLVDQLTLNAGVLGGPRVGWPDCPTSSKLDHPTHQILSSLFPCSG QRALL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G54920		PMR6	powdery mildew resistant 6, Pe...		Lus10038679 [exp]	0	1
AT3G01820			P-loop containing nucleoside t...		Lus10022342 [exp]	1.7	0.7712
AT3G54920		PMR6	powdery mildew resistant 6, Pe...		Lus10037945 [exp]	4.4	0.7875
AT3G02900			unknown protein		Lus10009524 [exp]	5.5	0.7495
AT5G22740		ATCSLA2, ATCSLA...	CELLULOSE SYNTHASE-LIKE A 2, A...		Lus10009387 [exp]	16.2	0.7239
AT5G55160		ATSUMO2, SUMO2,...	small ubiquitin-like modifier ...		Lus10022539 [exp]	24.7	0.7214
AT3G13510			Protein of Unknown Function (D...		Lus10013410 [exp]	27.7	0.7211
AT4G35740		ATRECQ3, RECQL3	A. THALIANA RECQ HELICASE 3, D...		Lus10041840 [exp]	29.0	0.7159
AT1G45130		BGAL5	beta-galactosidase 5 (.1)		Lus10000803 [exp]	29.1	0.7310
AT5G65920			ARM repeat superfamily protein...		Lus10005500 [exp]	33.2	0.7459
AT3G20320		ABCI15, TGD2	ATP-binding cassette I15, trig...		Lus10007420 [exp]	34.8	0.7185

Compare expression of checked genes

Lus10038679 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.