Lus10038703 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G04260 189 / 9e-61 WCRKC2 WCRKC thioredoxin 2 (.1)
AT5G06690 133 / 1e-38 WCRKC1 WCRKC thioredoxin 1 (.1.2)
AT1G03680 50 / 2e-07 ATHM1, ATM1, TRX-M1 ARABIDOPSIS THIOREDOXIN M-TYPE 1, thioredoxin M-type 1 (.1)
AT3G15360 47 / 2e-06 ATHM4, ATM4, TRX-M4 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037975 181 / 1e-58 AT5G04260 149 / 3e-47 WCRKC thioredoxin 2 (.1)
Lus10021067 136 / 6e-40 AT5G06690 215 / 3e-71 WCRKC thioredoxin 1 (.1.2)
Lus10017244 99 / 1e-25 AT5G06690 156 / 2e-48 WCRKC thioredoxin 1 (.1.2)
Lus10036698 42 / 5e-05 AT1G69880 113 / 5e-33 thioredoxin H-type 8 (.1)
Lus10013827 42 / 8e-05 AT3G53220 172 / 2e-56 Thioredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G225701 201 / 4e-65 AT5G04260 204 / 3e-67 WCRKC thioredoxin 2 (.1)
Potri.008G036400 194 / 9e-63 AT5G04260 216 / 8e-72 WCRKC thioredoxin 2 (.1)
Potri.016G059500 139 / 3e-41 AT5G06690 212 / 4e-70 WCRKC thioredoxin 1 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00085 Thioredoxin Thioredoxin
Representative CDS sequence
>Lus10038703 pacid=23143077 polypeptide=Lus10038703 locus=Lus10038703.g ID=Lus10038703.BGIv1.0 annot-version=v1.0
ATGTCTGAATCCGTACAACTCTCCCGAGTTCGTCCCATCGGAGTTTTGCGGCCCTCTTCCACAACACCTCCCACTTCCTCTGTATTTCCTTCCTCGTCAT
TTCCTTCTCATGGTTATCGAAATCGCTCCTTTTCGAGCTGCAGAGCTGTCTTCTCCTGCTCTGGATCACTCCCCGCTTCTAAACATTTGAAATTGGAATC
TCATCAAGCGTCTGGTTCTAAGTTTCCTATCTCTTATGTCGTCAACAACGGAAAAGGTTCCGTCCAGGAATTGGACGACGAGCCTGTATCGATTGACTTG
ATCCCCGTTTGCAGTGACACCCAATTTGATCTGGTTATAGCTGAGGCCGATCAGCTCCATGAAGCAGCTATTATTGTTTGGATGGCAAATTGGTGCCGAA
AATGTATATATTTGAAACCAAAGCTGGAAAGATTAGCAGCTGATTATCATCCCAGTCTGAGATTCTACTGCGTAGACGTCAACAACGTTCCTCACAAGCT
AGTAGCTCGAGCAGGAGTCACTAAAATGCCAACAATACAGGTAACAAAATCTCATCCCCCTTCTACTCTGGCATCACTCCTTGATCACCTGTGGAGAGAT
GGGGAGAAGCAAGGGGAAGTGATTGGCGGGCACAAGGCTTACCAGGTGATCAATGAAGTTCGACAAATGATCGAGACCAGTAGTATTGAGGGTGACCTCT
GA
AA sequence
>Lus10038703 pacid=23143077 polypeptide=Lus10038703 locus=Lus10038703.g ID=Lus10038703.BGIv1.0 annot-version=v1.0
MSESVQLSRVRPIGVLRPSSTTPPTSSVFPSSSFPSHGYRNRSFSSCRAVFSCSGSLPASKHLKLESHQASGSKFPISYVVNNGKGSVQELDDEPVSIDL
IPVCSDTQFDLVIAEADQLHEAAIIVWMANWCRKCIYLKPKLERLAADYHPSLRFYCVDVNNVPHKLVARAGVTKMPTIQVTKSHPPSTLASLLDHLWRD
GEKQGEVIGGHKAYQVINEVRQMIETSSIEGDL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G04260 WCRKC2 WCRKC thioredoxin 2 (.1) Lus10038703 0 1
AT2G04520 Nucleic acid-binding, OB-fold-... Lus10002264 1.4 0.9040
AT2G06530 VPS2.1 SNF7 family protein (.1) Lus10017166 3.7 0.8729
Lus10007667 4.0 0.8859
AT2G21620 RD2 Adenine nucleotide alpha hydro... Lus10026346 4.2 0.8729
Lus10040920 4.2 0.8887
AT3G57870 SCE1A, SCE1, AH... SUMO CONJUGATING ENZYME 1A, EM... Lus10019327 6.9 0.8527
AT1G03290 unknown protein Lus10012381 8.7 0.8496
AT1G14300 ARM repeat superfamily protein... Lus10036742 9.2 0.8565
AT3G13970 APG12B, APG12 AUTOPHAGY 12 B, AUTOPHAGY 12, ... Lus10000432 9.7 0.8763
AT5G15730 CRLK2, AtCRLK2 calcium/calmodulin-regulated r... Lus10008540 12.0 0.8866

Lus10038703 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.